KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17870Help
Entry
Dmel_CG17870      CDS       T00030                                 

Gene name
14-3-3zeta
Definition
(RefSeq) 14-3-3zeta, isoform J
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG17870 (14-3-3zeta)
   04391 Hippo signaling pathway - fly
    Dmel_CG17870 (14-3-3zeta)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG17870 (14-3-3zeta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG17870 (14-3-3zeta)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    Dmel_CG17870 (14-3-3zeta)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG17870 (14-3-3zeta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3
Motif
Other DBs
NCBI-GeneID: 36059
NCBI-ProteinID: NP_001014515
FlyBase: FBgn0004907
UniProt: P29310 A0A0B4KEH0
Position
2R
AA seq 248 aa AA seqDB search
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRS
SWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVF
YLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVF
YYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA
EPQEGGDN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagtcgataaggaagagctggtccagaaggctaaactggccgagcagtcagaa
cgttacgatgatatggcccaggccatgaagtccgtcacagagactggcgttgagctctca
aatgaggaaagaaatctgctctccgttgcctacaaaaatgtggtcggtgcccgcaggtca
tcgtggcgtgtcatctcctccattgagcagaaaaccgaagcatccgctagaaaacagcag
ctcgcccgtgagtacagagagcgtgtggagaaggagctgagggaaatctgctacgaagtt
ttgggacttctggacaaataccttattccaaaagccagcaatcccgagagcaaggtgttt
tacctgaagatgaagggtgattactacaggtatttagccgaggttgccacaggagatgca
cgcaacaccgttgtcgatgactcgcaaaccgcttaccaggatgcatttgacattagcaag
ggtaaaatgcagccaacacatcccatccgtttgggtctggcccttaacttctcagtcttc
tactatgagattttgaactcaccagacaaagcttgccaattggctaaacaggcgttcgat
gatgcgatagccgagctggacacactgaacgaggactcctacaaggactcgacactcatc
atgcagctgttgagggacaacctgactctctggacgtccgacacccaaggcgacgaagct
gagccacaggagggcggcgacaactaa

DBGET integrated database retrieval system