KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18028Help
Entry
Dmel_CG18028      CDS       T00030                                 

Gene name
lt
Definition
(RefSeq) light, isoform F
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG18028 (lt)
Membrane trafficking [BR:dme04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    Dmel_CG18028 (lt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin TPR_7 WD40 ANAPC3 TPR_1 zf-RING_2 zf-rbx1 zf-RING_11 TPR_2 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 3355130
NCBI-ProteinID: NP_001036415
FlyBase: FBgn0002566
UniProt: Q7PL76
Position
2L
AA seq 841 aa AA seqDB search
MAKALPLISCDSWADSINEEDVEPKFKYHRLANDLKYMLNADVITCSAVHLKFLIFGTFR
GRVCIFDHQGNSVYSNLSASERHTHQVAVNNIDVDHKGEYVATCSDDGKVNITGLFSSDN
NHSLSFGKFIKVVSLEPDSKAHIKRFVVGDDKLILYERNLLKKLKPVELCSVEGSVLSIC
WHGNFIAWASHIGVRVYDLNERCSLGLIKWEVPPQERLENFRCHLRWSNKHTLLIGWVDT
IRVCVIRKRNSIEASTGNLPVYIVDPISTFQTTFYVCGLAPLSAKQLVVLGFRKEKSSCF
KALRPVLCVIEYKMNNSEEICTDSLTLRGFEEYTVNDYSLGGIIEENRFYIVAPKDIVVA
SLIETDDRIEWLIKHSKFEEAMELISANGGNVPVLSVAKLYINHLLALKKYDDAAKLCLR
MLGNDKVLWEEEVFKFVKCQQLRSVSAYLPTSDECKLDPHVYEMVLYEFLKFDVCGFLNL
IKEWPSHLYDGLAVINAIHDNFRKHYANQLLESLALLYSYQGDFESALRMYLKLQNKDVF
QLIRRYELYDVISKLIIPLIQLDRDCAFEILLDKKKIKTEIVVHQLEHNQEYLYWYLDSL
LKKDPSNVFQKKLISLYAIFDRNKLLPFLKRSKDYDIQEALVICKQENFYPEIVYLLGCM
GGVEASEALNIIIHRIRDIEMAIEFCKEHDDSDLWNALINEFSKHPEIVTKVLDGIVDYF
SPAVVVGKIKMGQNIPNLRQSLIKMLRHYNLQGEILSSAQQIQLNDYFEIHSEIVTTQRR
GQQVSYEQLCSLCHRPVLMAGTHLYCIIRLECGHVYHKPCIQGELLKNCNECNLWKLTVG
K
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgttgccgctcatcagttgtgactcttgggccgatagcataaatgaggaa
gatgtggagcccaaatttaagtatcaccgtctcgcaaatgatttaaaatacatgctcaac
gctgatgtcatcacttgtagcgctgtacacttaaagtttcttatatttggaactttccga
ggacgtgtttgtatatttgaccatcaaggaaactcagtctactcaaatcttagcgctagc
gaacgtcacactcaccaagtggcagtaaacaatatagatgtagatcataagggcgagtat
gtggccacatgctccgacgacggaaaagttaacataacgggattgtttagctctgataac
aatcacagtctcagctttggcaaatttataaaggtcgtatcactggagcccgattccaaa
gctcacattaaaagatttgtagtgggcgacgacaaacttatcttgtacgagcgaaacttg
ctaaagaagcttaaaccagttgaactgtgctcagtcgaaggcagtgttttgtcaatctgc
tggcatggcaactttattgcctgggcaagtcacataggagttcgagtctacgatttaaac
gaaagatgctcacttggattaataaagtgggaggttcctcctcaggagcgattagaaaat
tttcgatgccaccttcgttggtccaacaagcatacattattaattggctgggtagacact
attcgagtttgcgtaattcgaaagagaaattcaatcgaagcttcaactggcaatctgcct
gtctacattgtggatccaatctcgacatttcaaacaactttctacgtatgtgggcttgca
ccattatctgcaaagcaattggttgttcttggctttcgcaaggaaaaaagctcttgtttt
aaagccctacgacctgtattatgcgttattgaatacaaaatgaataatagcgaggaaatc
tgcacagacagtttaactttacgcggctttgaggagtacaccgtgaatgactatagtctg
ggtggcataatcgaggagaatcgcttttatattgtggccccaaaggatattgtggtagct
agtcttattgaaacagatgatcgtatagaatggttgattaaacacagtaaatttgaggag
gcaatggaacttatatctgcgaatggaggtaacgttcccgtactttccgttgctaaactt
tatatcaaccatttactggcgcttaagaagtatgatgacgcagcaaaactttgcctccgc
atgctaggcaatgacaaagtcctttgggaagaggaagtttttaagtttgtaaagtgtcag
cagctacgatcagttagcgcctatctgccgacttcagacgaatgcaaacttgatccccat
gtatacgaaatggttttatacgagtttctcaaatttgatgtatgtggtttcctgaatctt
atcaaggaatggccatctcatctttatgacggcctggctgttattaacgctattcacgat
aactttcgaaagcactatgccaatcagttgctggaatcattggctcttttgtattcctat
caaggcgacttcgaaagtgctcttcgcatgtatttaaagttgcagaacaaggatgtcttc
caattaattcgacggtatgagctttacgatgtcatttcaaaactgattattccacttatt
caattggatcgtgactgcgcctttgaaatactacttgacaagaaaaaaataaagactgag
atagttgtccaccagctagagcacaatcaagagtacctgtactggtacttagattcttta
cttaaaaaggatcccagtaatgtgtttcaaaaaaaacttatctccttatatgccattttc
gatcgaaacaaactattgccctttctaaagcgttcaaaggactatgacattcaggaggcg
ttggtcatatgcaaacaggaaaacttttatccagaaatagtctacctgctcgggtgtatg
ggtggcgtagaagcgtccgaagcacttaatattattattcatcgcatcagagacatagaa
atggccatagagttttgcaaggagcacgatgacagcgatctttggaatgcacttataaat
gaatttagcaagcaccctgaaattgtgaccaaagttttggacggcatagttgactacttt
agcccagcggtggttgttggaaagatcaaaatgggacagaacattccaaatcttcgacaa
tcacttataaaaatgctgcgccactacaatcttcaaggtgaaattttatcctccgcccaa
caaattcaacttaatgactattttgaaattcactcggagatagtcaccacgcaaagacga
ggtcagcaggtttcctacgaacaactatgctcattgtgccaccgtccagtactgatggca
ggcacacacttgtattgtataatcaggttagagtgtggtcatgtataccataaaccgtgc
atacaaggtgaattgcttaaaaattgcaacgagtgtaacctttggaagttaaccgtgggg
aaatag

DBGET integrated database retrieval system