KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18095Help
Entry
Dmel_CG18095      CDS       T00030                                 

Gene name
CG18095
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRR_1
Motif
Other DBs
NCBI-GeneID: 34823
NCBI-ProteinID: NP_001188805
FlyBase: FBgn0028872
UniProt: M9MSI4
Position
2L
AA seq 564 aa AA seqDB search
MYLLPGSLLLLIFSFSPRLSCLQLSKCNNTEVTLIRKTELLTSLTLSNCTLPHVENGFFV
RFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGALTNLDLSH
NMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGSFFR
GLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHLNLSS
NLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLD
SLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSG
NAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANL
VQKLPNSVNFARPWTVINNLSENTTNVEGIDCIEGGTNRSIILLDVSGVPQPKSDNCDCV
VAYDETNPSPPPLTWPKIPTDRFDSRSVIIWMLVAIAIAFSGLRWLRRFVDRNEKRKLGQ
KMLHNVYVSKVQWQAIRTDPDQRS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtacctactacctggtagtctactcctgctgatctttagctttagcccgaggttaagt
tgcctgcagttgagcaagtgcaataatactgaggtgaccttaatacggaagacggagctc
ttgacgtcactcacattgagcaactgcacgctgccgcatgtggaaaatggatttttcgta
cggtttgatcatctgcttcatttagaactgcagcacagtggactgagtgatttagatgat
ttttcactgaatggcttgacaaagttacaatacctttccctgtcccacaacaatctgagc
agtctgagatcctggtccagtgagcctttgggtgcattaaccaatttggatctaagccac
aatatgttaagcaaactgagtgtcaagagctttgagcaatatccccagttgcaacagctc
gacttgcgttacaatcggattagtcaaatagagaatgactcctttgatggattatctcat
ttaaagcatctttatctgaacggaaaccaactggcgcacatagatggtagtttctttcgg
ggtcttcatcggctatccagtttatcactgcagcacaatcgcattgagttcatagaaatg
gattcgtttgagagtaatacccatcttcgaagtctacggctggaccaaaatctcctgagc
agtcttcagtttctcagtcaacgaggtttggctcgactggttcacttgaatctatcgagt
aatctgctacaaaaattggagccatttgtattttccaaaaactttgagctgcaggaccta
gacttgagttataataacataactaagctcaacaaggaagcattatcgggattggattct
ttggagcgcctcaacataagtcataactatgtggataaaatatatgacgaaagcctggac
tccctaatcgctcttcttcaactagatattagcttcaaccttctgaccacactgccagat
aatttattccatttcaacactcaattggaagagattatccttgctaataacaaaatagaa
gagatatcctctcagatgatgttcaatcaaaatcatttaagatacattaaattgtcggga
aatgcaatcagtgatgccgctttcctcgacaggctttctccatcggtgaatcgttttact
ctctacgtggatctcagttcgaatcgcctcaaatcgttgaacctcagcagtcttcttcat
tttcgctatataaacttggcggataataactggagctgcaattggttggtggctaacttg
gtgcaaaaattaccaaactctgttaacttcgctcgtccctggactgtaatcaataatttg
agtgaaaataccacaaatgtagagggaatagactgcattgaagggggcactaatcgttcc
ataatattgctggatgtaagtggcgtgccacaaccaaaatcagacaattgcgattgtgtt
gttgcctatgatgagacaaatccttcacctccaccgctcacctggccgaagataccaaca
gatcgctttgattcacgatcggtgatcatttggatgctggtggccattgcgatagctttt
tcaggacttcgttggttgcgacggttcgtggatcgcaatgagaaacgtaaactgggccaa
aagatgctgcataatgtgtacgtcagcaaagttcagtggcaggcgatcagaaccgatccc
gatcagagatcgtag

DBGET integrated database retrieval system