KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18104Help
Entry
Dmel_CG18104      CDS       T00030                                 

Gene name
arg
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00220  Arginine biosynthesis
dme00330  Arginine and proline metabolism
dme01100  Metabolic pathways
dme01230  Biosynthesis of amino acids
Module
dme_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dmel_CG18104 (arg)
   00330 Arginine and proline metabolism
    Dmel_CG18104 (arg)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dmel_CG18104 (arg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase PAS_8
Motif
Other DBs
NCBI-GeneID: 46717
NCBI-ProteinID: NP_524875
FlyBase: FBgn0023535
UniProt: O76895
Position
X
AA seq 351 aa AA seqDB search
MWWSRKFASRSLRLHRLKSTGSTAPREPEQSLGIIGVPFAKGQAKQGVELAPDLLRQSSL
RQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFMACNRALIEQVKLMLV
ENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLL
EQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVP
KIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQ
GVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGRWSNIDTGILGSD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggagccgtaaatttgcctcaaggtctctccgcctccaccggctcaagagcacc
ggaagcactgcgcccagggaacctgagcaatctctaggcatcattggagtgcccttcgca
aaggggcaggccaagcagggcgtggaactggcgccagatcttctccggcagagcagtctg
cgtcaggtgcttcagagcagtcatgatggcctggtgatacgggactacggaaatctgcag
tacgccgtagacgagccccttctccagcagcagcgtgtgcactatcaccacatccgaaac
tacgcggacttcatggcctgcaatcgggcactgattgaacaggtgaaactcatgctcgtg
gagaacacgcagtttttagccattggtggtgatcatgcgatcggcttcggatccgtggcc
gggcacctgcaacacacgccgaatttgtccctggtgtggatcgacgcacatgcggacatc
aatctgcatagcacctcgcagtcgggcaacatccatgggatgcctgtatcctttctgttg
gaacagctccgtaacacctggcagcacgctggcctccaggaaatcgcgcccaactgcttg
cccaaggatcagctggtttacatcggactccgggacattgacccctacgaggcgttcatc
ctaaacaaagtcggaatacgctactatgcaatggataccatcgaccgggtgggcgtgccc
aagattatcgagatgacgctggacgcccttaatccgcagaacaagatccacgtcagcttt
gacatcgacgccttggacagcaatgtggcgcctagcactggcaccgcggtgcgcggtggc
ctcacgctccgcgagggaatcagcatcgtggaggcactccgggacaccaagcgggtgcag
ggcgtcgatctggtggagatcaacccaaagctaggcagcgagcgcgacgtgcgcaccact
gtggagtccggcctggagatactgaagagcatgttcggttaccggcgttcggggcgctgg
agcaacatcgataccggaatccttggtagcgattaa

DBGET integrated database retrieval system