KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1849Help
Entry
Dmel_CG1849       CDS       T00030                                 

Gene name
run
Definition
(RefSeq) runt, isoform C
  KO
K20213  RUNX transcription factor Runt
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG1849 (run)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    Dmel_CG1849 (run)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Runt
Motif
Other DBs
NCBI-GeneID: 33059
NCBI-ProteinID: NP_001285501
FlyBase: FBgn0003300
UniProt: P22814 X2JEJ3
Position
X
AA seq 510 aa AA seqDB search
MHLPAGPTMVANNTQVLAAAAAAAAAAAAAVAQGPGPQQSSNATTASAIAINPAQSLANT
STHSASSTGSSTPDLSTNNTSSSSNATTSPQNSAKMPSSMTDMFASLHEMLQEYHGELAQ
TGSPSILCSALPNHWRSNKSLPGAFKVIALDDVPDGTLVSIKCGNDENYCGELRNCTTTM
KNQVAKFNDLRFVGRSGRGKSFTLTITIATYPVQIASYSKAIKVTVDGPREPRSKQSYGY
PHPGAFNPFMLNPAWLDAAYMTYGYADYFRHQAAAQAAQVHHPALAKSSASSVSPNPNPS
VATSSSSAVQPSEYPHPAAAVAAAAGQPAAMMPSPPGAAPATPYAIPQFPFNHVAAAAAA
KAATPHAFHPYNFAAAAGLRARNAALHHQSEPVHVSPASSRPSSSSPTQQHVLLKLNTSI
ETSSIHEQSASDGDSDDEQIDVVKSEFDLDKSLDVAPLRMRCDLKAPSAMKPLYHESGPG
AVANSRQPSPETTTKIKSAAVQQKTVWRPY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgccagcgggtccaacgatggtggccaacaacacacaggtcctggccgctgcc
gccgccgcagcagccgccgcagcggccgcggtagcccagggtcctgggccgcagcagagt
agcaatgccaccaccgcctccgcaatcgccatcaatcccgcccagagtctggccaacacg
agcacccactcggccagcagcacgggcagctccacaccagatctcagcacgaacaacacc
agctcgagcagcaacgccaccaccagtccgcagaactccgccaagatgcccagctcgatg
accgacatgttcgccagcctgcacgagatgctgcaggagtatcacggcgagctggcccag
accggatcgccctcgatcctctgcagcgccctgcccaatcactggcggtcgaacaagtcg
ctgcccggagccttcaaggtgatcgccctggacgacgtgcccgatggcaccctggtgtcc
atcaagtgcggcaacgacgaaaactactgcggcgagctgaggaactgcaccacgaccatg
aagaaccaggtggccaagttcaacgatctgcgcttcgtgggacgatcgggacgcggcaag
tccttcacgctgaccatcaccattgccacctatccggtgcagatcgccagctacagcaaa
gccatcaaggtgaccgtcgacgggccacgggagccaagaagtaagcaaagctatggctat
ccccatcccggcgcgtttaacccgttcatgctgaatcccgcttggctggatgcggcgtac
atgacctacggctatgcggactacttccgccaccaggcagccgcccaggcggcccaggtg
catcatccggcactggccaagtcctcggcttcctcggtgtcgccaaatcccaatccatcg
gtggccaccagctcctcgtcggcggttcagccatctgagtatccccatccggcggcagca
gtggcagcggcggcgggacaaccggcggccatgatgccatcgccaccgggagcggcgcct
gccacgccctatgccattccgcagttcccattcaaccatgtggccgccgcagccgccgcc
aaggcagccacgccacacgccttccatccgtataactttgccgcggcagctggcttgcgg
gcccgcaatgctgccctgcaccaccagagcgagccggtccacgtcagccccgcctcctcc
aggccctccagctcctcgcccacccagcaacacgtcctgctgaagctaaacacctccatc
gagacgagctccatccacgagcagtccgccagtgacggcgactccgacgacgagcagatc
gacgtggtcaaatcggagttcgacctggacaagagcctggatgtggcgccacttcgcatg
cgctgcgacctgaaggcgccctcggccatgaagccgctctaccacgagagcggtcctgga
gcggtagccaacagccgccagccgtcgccggaaacgaccaccaagatcaagagcgccgcc
gtgcagcagaagaccgtgtggcggccctactag

DBGET integrated database retrieval system