KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1859
Entry
Dmel_CG1859       CDS       T00030                                 

Symbol
Spn43Ad
Name
(RefSeq) serpin 43Ad
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin CppA_C
Other DBs
NCBI-GeneID: 35639
NCBI-ProteinID: NP_610261
FlyBase: FBgn0044011
UniProt: Q8SYY7
Position
2R
AA seq 407 aa
MIHWRLLSALLVGLAIALTLPVDGELLARSPASVSSNRFGLRLTTKLGLTQPDANVVVSP
LLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRL
LSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELV
SAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRY
RYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVA
LTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQ
EDGGNADDSFSFGDLFRRALPLVINHPFFYAIGNGKTLLLSGHIVDI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgatccactggagacttctttccgccctacttgtgggcctggctatagctttaacgctt
ccagtcgacggggagctcttggccagatcgccggccagcgtctcgagtaaccgctttggc
ctacgcctaactactaagttgggactaactcaaccagatgcaaatgtggtggtttccccc
ttgcttatacaggcggcgctcagcctgctgtatgcggaaagttcttcggagtacggtagc
caactccgccaggctctggagctgacccacgccagtcacccgaagcttgcggtgcaggac
ttcgagacccttttgacggacctcaagcagtcggctgccattggctgtcgcttgcggttg
ctgagtgacctctacgcacagcagcgcttcaccttcaacttccgcaatgaattcgagacc
ttggccgcccgaatgggcgtcggctgccaccgcttgtcgtgggaaagtgcgtcgaacgcg
gcccaggatatcaactacgccttccttagccgcagcaacttcagcctgggggagctcgtc
agtgccccccaactcgagtccttggccgagcacaacacgccctttttacacgtctcggga
gtcaccttccgagccccttgggcttgggccttcgatcctaccgagacgcagagcatcaac
ttctttgccgggggaaatcgccccaggctggtggatgccatgttcggacagcaccgctac
aggtacgctgaagtgcccgctctggacgcccagctcattgaggtgcccttcgccactgca
gacctccgaatgctcattgtatttcccaatcggcctgatggcctggcccaacttgagagg
aagctggcgcagtccgatctccaccagctaaggtcccagctcgaggagcgcaaggtggcc
ctcactctgcccaagctcagagtgctagtccactccgacctgaagcacgtgctcgaggag
ttgggtctggcaaaactattcacatcggaggtccacctgagcgaggtcttcagctccatc
ctgtccagttcggctccacccttgggagcagtggtccagagtggtctcctggagctacag
gaggatggcggcaatgccgacgactcgttctccttcggggatctgttccgacgagccctg
cccctggtcatcaatcacccgttcttttacgccatcggcaatggcaaaactctgctgctg
tccggccacatcgtcgacatctga

DBGET integrated database retrieval system