KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1865
Entry
Dmel_CG1865       CDS       T00030                                 

Gene name
Spn43Ab
Definition
(RefSeq) serpin 43Ab
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 45040
NCBI-ProteinID: NP_001027395
FlyBase: FBgn0024293
UniProt: A1Z6V5
Position
2R
AA seq 393 aa
MAVIISCLLLLLATVSQSKTVGYDAAADRNLLAADLYNAVAADHLNENVVISPATIQSSM
ALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGSYQQALTRDNNFRLANNIYINENLEF
KGSFRDVAQRQFDSNIDKLDFHPPYNKRTADGINRAVATKTNGKITDILRAELLNDRTEG
VIVNGVSYSAAWQKAFRLDKTEKRSFRTGSGQSVKVDTMWTLQNFNYAEVNSLDAKVVEL
PYQNPDFSMLLLLPNRKDGLRSLQQSLSGKNLLAEIGAMSQQKVEVLLPKFSVTFGLGLE
GPFKKLGVHTMFSRDGDFGNMYRMFVSHFINAVEHKANVEVTEAGVDQPLETGLLKGLFS
RSKKFEADHPFVFAIKYKDSIAFIGHIANYAYV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggctgtcatcatcagctgcctattacttctcctcgcgacagtgtcgcagtccaagacc
gtgggttacgatgcggctgccgatcgcaatttgctggctgccgatctctacaacgccgtg
gccgccgatcatctgaacgaaaatgtggtcatctcgccagcgaccatacagagttccatg
gcgctggccttcgtgggggccaagggtcagacggcatcggagttgcagcaggggctgcgt
ttaggtcctggcgatgcggatgcggtgagccagcgcagcggtagttaccaacaggccctg
acccgcgacaacaacttccggctggccaacaacatttacatcaacgagaaccttgagttc
aagggctccttcagggacgtggcccagcgccagttcgactcgaacatcgacaagctggac
tttcacccgccgtacaacaagcgcacggcggatggcatcaaccgggcggtggccaccaag
accaacggcaagatcactgacatcctccgcgccgagctgctgaatgatcgcaccgaggga
gtgatcgtgaacggcgtttcctactcagccgcctggcaaaaggccttccggctggacaag
accgaaaagcgctccttccgcaccggaagcgggcagtctgtcaaggtagacaccatgtgg
acgctgcagaacttcaactacgccgaggtcaactccctggacgccaaggtggtggagctg
ccctaccagaaccccgacttctccatgctgctgctcctgcccaatcgcaaggatggtctg
agatccctgcagcagtcgctgtccggtaagaatcttctggccgaaatcggagcgatgagc
cagcaaaaggtggaggtgctgctgcccaagtttagtgtcacctttggcttgggtttggag
ggaccattcaagaagctgggcgtccatacaatgttctcgagagatggtgactttggcaac
atgtaccgcatgtttgtcagccatttcattaacgcagtggagcacaaggccaatgtggag
gtcactgaagctggcgtggatcaacccctggaaactggattgcttaaaggactcttttcg
cgctccaagaagttcgaggcagatcatccgttcgtgttcgccatcaagtacaaggactca
atcgcctttatcggacacattgctaactatgcttatgtctaa

DBGET integrated database retrieval system