KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18802
Entry
Dmel_CG18802      CDS       T00030                                 

Gene name
alpha-Man-IIa
Definition
(RefSeq) alpha-Mannosidase class II a, isoform A
  KO
K01231  alpha-mannosidase II [EC:3.2.1.114]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00510  N-Glycan biosynthesis
dme00513  Various types of N-glycan biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmel_CG18802 (alpha-Man-IIa)
   00513 Various types of N-glycan biosynthesis
    Dmel_CG18802 (alpha-Man-IIa)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     Dmel_CG18802 (alpha-Man-IIa)
SSDB
Motif
Pfam: Glyco_hydro_38N Glyc_hyd_38C_2 Glyco_hydro_38C Alpha-mann_mid
Other DBs
NCBI-GeneID: 41126
NCBI-ProteinID: NP_524291
FlyBase: FBgn0011740
UniProt: Q24451
Structure
PDB: 

Position
3R
AA seq 1108 aa
MLRIRRRFALVICSGCLLVFLSLYIILNFAAPAATQIKPNYENIENKLHELENGLQEHGE
EMRNLRARLAETSNRDDPIRPPLKVARSPRPGQCQDVVQDVPNVDVQMLELYDRMSFKDI
DGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRH
LHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRN
VLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKEL
AQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSC
PWKVPPRTISDQNVAARSDLLVDQWKKKAELYRTNVLLIPLGDDFRFKQNTEWDVQRVNY
ERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSG
YYTSRPYHKRMDRVLMHYVRAAEMLSAWHSWDGMARIEERLEQARRELSLFQHHDGITGT
AKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVE
DSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWS
WHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPT
SLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGV
RSHGDRSGAYLFLPNGPASPVELGQPVVLVTKGKLESSVSVGLPSVVHQTIMRGGAPEIR
NLVDIGSLDNTEIVMRLETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFI
EDANTRLTLLTGQPLGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLE
KVNNCVRPSELHPAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHPSAREDL
DVSVMRRLTKSSAKTQRVGYVLHRTNLMQCGTPEEHTQKLDVCHLLPNVARCERTTLTFL
QNLEHLDGMVAPEVCPMETAAYVSSHSS
NT seq 3327 nt   +upstreamnt  +downstreamnt
atgttgcgaatacgtcggcggttcgctttggtaatttgctccggctgcctgctggttttc
ctcagcctgtacataatcctcaattttgcggcgccggcagccacccagataaagcccaac
tatgagaacattgagaacaagctgcatgagctggaaaatggtttgcaggagcacggggag
gagatgcggaatctcagggcgcgtcttgccgaaacatccaatcgcgacgatccaataaga
cctccacttaaagtggctcgttccccgaggccagggcaatgccaagatgtggtccaagac
gtgcccaatgtggatgtacagatgctggagctatacgatcgcatgtccttcaaggacata
gatggaggcgtgtggaaacagggctggaacattaagtacgatccactgaagtacaacgcc
catcacaaactaaaagtcttcgttgtgccgcactcgcacaacgatcctggatggattcag
acgtttgaggaatactaccagcacgacaccaagcacatcctgtccaatgcactacggcat
ctgcacgacaatcccgagatgaagttcatctgggcggaaatctcctactttgctcggttc
tatcacgatttgggagagaacaaaaagctgcagatgaagtccattgtaaagaatggacag
ttggaatttgtgactggaggatgggtaatgccggacgaggccaactcccactggcgaaac
gtactgctgcagctgaccgaagggcaaacatggttgaagcaattcatgaatgtcacaccc
actgcttcctgggccatcgatcccttcggacacagtcccactatgccgtacattttgcag
aagagtggtttcaagaatatgcttatccaaaggacgcactattcggttaagaaggaactg
gcccaacagcgacagcttgagttcctgtggcgccagatctgggacaacaaaggggacaca
gctctcttcacccacatgatgcccttctactcgtacgacattcctcacacctgtggtcca
gatcccaaggtttgctgtcagttcgatttcaaacgaatgggctccttcggtttgagctgt
ccatggaaggtgccgccgcgtacaatcagtgatcaaaatgtggcagcacgctcagatctg
ctggttgatcagtggaagaagaaggccgagctgtatcgcacgaacgtgctgctgattccg
ttgggtgacgacttccgcttcaagcagaacaccgagtgggatgtgcagcgcgtgaactac
gaaaggctgttcgaacacatcaacagccaggcccacttcaatgtccaggcgcagttcggc
acactgcaggaatactttgatgcagtgcaccaggcggaaagggcgggacaagccgagttt
cccacgctaagcggtgactttttcacatacgccgatcgatcggataactattggagtggc
tactacacatcccgcccgtatcataagcgcatggaccgcgtcctgatgcactatgtacgt
gcagcagaaatgctttccgcctggcactcctgggacggtatggcccgcatcgaggaacgt
ctggagcaggcccgcagggagctgtcattgttccagcaccacgacggtataactggcaca
gcaaaaacgcacgtagtcgtcgactacgagcaacgcatgcaggaagctttaaaagcctgt
caaatggtaatgcaacagtcggtctaccgattgctgacaaagccctccatctacagtccg
gacttcagtttctcgtactttacgctcgacgactcccgctggccaggatctggtgtggag
gacagtcgaaccaccataatactgggcgaggatatactgccctccaagcatgtggtgatg
cacaacaccctgccccactggcgggagcagctggtggacttttatgtatccagtccgttt
gtaagcgttaccgacttggcaaacaatccggtggaggctcaggtgtccccggtgtggagc
tggcaccacgacacactcacaaagactatccacccacaaggctccaccaccaagtaccgc
atcatcttcaaggctcgggtgccgcccatgggcttggccacctacgttttaaccatctcc
gattccaagccagagcacacctcgtatgcatcgaatctcttgctccgtaaaaacccgact
tcgttaccattgggccaatatccggaggatgtgaagtttggcgatcctcgagagatctca
ttgcgggttggtaacggacccaccttggccttttcggagcagggtctccttaagtccatt
cagcttactcaggatagcccacatgtaccggtgcacttcaagttcctcaagtatggcgtt
cgatcgcatggcgatagatccggtgcctatctgttcctgcccaatggaccagcttcgcca
gtcgagcttggccagccagtggtcctggtgactaagggcaaactggagtcgtccgtgagc
gtgggacttccgagcgtggtgcaccagacgataatgcgcggtggtgcacctgagattcgc
aatctggtggatataggctcactggacaacacggagatcgtgatgcgcttggagacgcat
atcgacagcggcgatatcttctacacggatctcaatggattgcaatttatcaagaggcgg
cgtttggacaaattacctttgcaggccaactattatcccataccttctggtatgttcatt
gaggatgccaatacgcgactcactctcctcacgggtcaaccgctgggtggatcttctctg
gcctcgggcgagctagagattatgcaagatcgtcgcctggccagcgatgatgaacgcggc
ctgggacagggtgttttggacaacaagccggtgctgcatatttatcggctggtgctggag
aaggttaacaactgtgtccgaccgtcagagcttcatcctgccggctatttgacaagtgcc
gctcacaaagcatcgcagtcactgctggatccactggacaagtttatattcgctgaaaat
gagtggatcggggcacaggggcaatttggtggcgatcatccttcggctcgtgaggatctc
gatgtgtcggtgatgagacgcttaaccaagagctcggccaaaacccagcgagtaggctac
gttctgcaccgcaccaatctgatgcaatgcggcactccagaggagcatacacagaagctg
gatgtgtgccacctactgccgaatgtggcgagatgcgagcgcacgacgctgactttcctg
cagaatttggagcacttggatggcatggtggcgccggaagtgtgccccatggaaaccgcc
gcttatgtgagcagtcactcaagctga

DBGET integrated database retrieval system