KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1885
Entry
Dmel_CG1885       CDS       T00030                                 

Gene name
Uros1
Definition
(RefSeq) uroporphyrinogen III synthase 1, isoform B
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00860  Porphyrin and chlorophyll metabolism
dme01100  Metabolic pathways
dme01240  Biosynthesis of cofactors
Module
dme_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG1885 (Uros1)
Enzymes [BR:dme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dmel_CG1885 (Uros1)
SSDB
Motif
Pfam: HEM4
Other DBs
NCBI-GeneID: 31817
NCBI-ProteinID: NP_001259362
FlyBase: FBgn0030066
UniProt: Q9W3B3
Position
X
AA seq 277 aa
MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLDELRAKLQNPDKYAG
IIFTSPRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARA
LGDYIVDTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVER
ALEIYGESIEFLAFFSPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESLGQKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERMAAIENNN
NT seq 834 nt   +upstreamnt  +downstreamnt
atgacgagtcgccagcgaactgtgatcatattcaaatcggaatcggaaagcagcgatgtg
tacgcagaaacgctggagaagcacgatttcaatcccgtctttgtgcccacgctgagtttc
ggcttcaagaatctcgatgagctgcgcgccaagcttcagaatccggataaatatgccggc
atcatattcacatcgccgcgctgcgtggaggccgtggctgaatccctcaatctcggcgag
ctacccggcggttggaagatgttgcataactatgccgtcggcgaggtgacccacaatctg
gcgctaagcaccttggaccagctattcacccacggcaaacagacgggcaatgcccgggca
ttgggcgactatatagtggatacgttcgatggatcgcgtgcattgccgctactattgcca
tgcggtaatctggccaccgatacgctgctatccaagctggccgagaatggcttctccgtg
gatgcgtgcgaagtgtacgagacgcgctgtcatcccgaattgggcgccaatgtggagagg
gcattggagatttatggcgagtcgattgaatttcttgccttcttctcgccatcgggcgtc
aattgtgcacagcagtacttcaccagccgtcagctatcgatggacaaatggaagctggtg
gccatcgggccgagcactaggcgtgccctcgaatcgctgggccaaaaggtttactgcacc
gccgagcggccgacggtggagcatctggtcaaggtgctgctcaatccgcaggacagtcgg
gagcggttgctcaaggagcgcgaacggatggccgccatcgagaataacaattaa

DBGET integrated database retrieval system