KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2072
Entry
Dmel_CG2072       CDS       T00030                                 

Gene name
Mad1
Definition
(RefSeq) mitotic arrest-deficient 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG2072 (Mad1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     Dmel_CG2072 (Mad1)
SSDB
Motif
Pfam: MAD ZapB BLOC1_2 MHC_II_beta
Other DBs
NCBI-GeneID: 35954
NCBI-ProteinID: NP_610477
FlyBase: FBgn0026326
UniProt: Q7KND8
Position
2R
AA seq 730 aa
MDDIRSSIDDMMDRFNDSITHSAPKKLLFNRLSASFDLGVSPNKRRRERESPERSLNDTA
SSLNMPANDSMASLQNSKLRTELIETKAIVIQLRNEIEKKSREHKEAILLAENKSTALKD
QCDITSKKNLELQDDLKALRKRELVLKNEASRATAELNQLRLKFDESTLKLQKEKYLQKE
DARDVHLCINNELSEYRRIAQRADLELQSTRNELERLRQLNEELQARASGFEQLRANHEK
QTQSLKVANDRIQELEFEIQSYSDWKEVVKTSRERLASVPDLLAEVEHLRSHNKHLNTLI
GDKLLLEEQVYDYKTRLEREEGARAEAASLQVKLLHMEQELKEWVKVAQDHCLANTLVSP
MALRSRIEQLLKEDIIHVAEKTSSASDTKHLNTTIRDLEHKCAIYLKNIEDLNIGLKRHK
NFKERLQRKLITVSKERDFYKQLVENFDKDTTLSNASVADMTQDMQVRVRMEVLERTVTG
YKDMCATLEREIQSLRQQELVNEPAGEGYDSVKKELDTLRMENDRLRRRKEELEMEMMHR
CLRGDFNMKDFKVVHFSENPAAEAYESTKNMMEKLQAEIERLKRRNKKLEDDNEQRLNET
TSTGGMTLNFKEFNQLQAELESANGKMRKMRDCFKAAREEFRDVCYMLLGYRIDRIGANS
NYRISSMFAEGPDDYLDISLNESNCLALLESPYSHTFNPPIDQQLAASNFPAFFSALTLE
LFQKATVTMT
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggacgacatacgtagcagcatagatgatatgatggaccgctttaacgacagcattacc
cattcggcacccaagaaactacttttcaaccggctttccgcctccttcgatttaggagtt
tcacccaataagcgacgtcgggaacgggaatcaccggaacgcagtcttaacgacaccgcc
tcttccctcaatatgcccgccaacgattccatggcttctttgcagaacagcaaactacgg
accgagctgatcgaaaccaaggccatagtaattcagctgcgtaacgaaatcgaaaagaag
agccgggaacacaaagaggccatattgctggctgagaacaagagcacggccttaaaggat
cagtgcgacatcaccagcaagaagaatttggagctgcaggacgatcttaaggcgcttcgt
aagcgagagctggtcttgaagaatgaggccagtcgggccaccgccgagttgaaccaactt
aggcttaagttcgatgaatccacgctcaagttgcagaaggagaagtacctgcagaaggag
gatgcccgcgatgtgcacctgtgcatcaacaacgaactgagcgaatatcgccgcatagcc
cagcgggccgatctcgaactgcagtctacgcgcaacgaactggagcgcctacgtcaactc
aatgaggagttacaggccagggcttccggattcgagcagctgcgcgccaatcacgagaag
caaacgcaaagcttgaaggtggccaacgatcgcattcaggagctggagttcgaaattcag
tcgtatagcgactggaaggaggtggtcaaaacctcacgagagcgcctggccagtgttcca
gatttgctagctgaggtggagcatctgcgcagccacaacaagcatttaaacactctgata
ggcgataaattgcttctggaggagcaggtctacgactacaaaacgcgactggagcgggag
gaaggtgctcgggcggaagcagcttccctgcaggtgaaactgcttcacatggagcaagaa
ctcaaggaatgggtcaaggtggcccaggatcactgcttggccaacactttggtcagccca
atggccctacgctcgcgcattgagcaactgctaaaagaagacatcattcacgtggcagag
aagacatcatcggcttcggataccaagcatttgaataccacaattcgagatctagagcat
aagtgcgccatttacttgaagaacatcgaggatctcaatatcggactgaaacgccacaag
aacttcaaggagcgactgcagcgcaaactgatcaccgtgtctaaggagcgcgacttctac
aaacaactggtggaaaacttcgacaaggacacgaccctgagcaatgccagtgtggcggac
atgacgcaggacatgcaggtgcgggtccgaatggaggtgcttgaacgcaccgtaaccgga
tacaaggacatgtgtgccacgttggaacgcgagattcaatccttgcgccagcaggagctt
gtgaacgaacctgccggagagggatacgatagcgtcaaaaaggaactggatacgctgcgg
atggaaaacgatcggctgcgtcggcgcaaggaggaactggagatggagatgatgcaccgc
tgcttgcggggcgacttcaacatgaaggacttcaaggtggtacactttagtgaaaatccc
gctgccgaagcctatgagtccaccaaaaacatgatggagaagctgcaggcggagattgag
cgactcaagcggcgcaacaagaagttggaggacgataacgagcaaaggctcaatgaaacc
accagcacgggcggcatgacactgaactttaaggagttcaatcaacttcaagccgaatta
gagtccgccaatggcaagatgcggaagatgagggattgcttcaaggcggcccgagaggag
ttccgcgatgtgtgctacatgctgctaggctataggatcgatcgaatcggtgccaacagc
aactatcgcatatcgagcatgtttgcagagggaccggatgactatctggacatcagcctc
aacgaatcgaactgtttggcgctactggagtcgccatattcgcacacattcaatccacct
attgatcagcagctggcagccagcaactttcccgcattcttttccgccctcaccctagaa
ctattccaaaaggccactgtcacgatgacttag

DBGET integrated database retrieval system