KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2078Help
Entry
Dmel_CG2078       CDS       T00030                                 

Gene name
Myd88
Definition
(RefSeq) Myd88, isoform B
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Module
dme_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG2078 (Myd88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR Death
Motif
Other DBs
NCBI-GeneID: 35956
NCBI-ProteinID: NP_001260821
FlyBase: FBgn0033402
UniProt: Q7K105
Position
2R
AA seq 537 aa AA seqDB search
MRPRFVCHQQHSVAHSHYQPHSHFHHHTHRHPNPPHHHHIYGATDVSYRRYRTAGMVVAE
GVMDSGSGSGTGTGLGHFNETPLSALGIETRTQLSRMLNRKKVLRSEEGYQRDWRGISEL
AKQKGFVDENANNPMDLVLISWSQRSPQTAKVGHLEHFLGIIDRWDVCDDIQENLAKDTQ
RFIMKQEQRQTALVEACPPPPSDCFETNNNYSSSNNITVGQSVQILSDEDQRCVQMGQPL
PRYNACVLYAEADIDHATEIMNNLESERYNLRLFLRHRDMLMGVPFEHVQLSHFMATRCN
HLIVVLTEEFLRSPENTYLVNFTQKIQIENHTRKIIPILYKTDMHIPQTLGIYTHIKYAG
DSKLFNFWDKLARSLHDLDAFSIYSTRQVQTPSPVEESAPRVTTPSIRIQINDKDVTDMP
NYNSCKVPEAETTIVSVSGDTGSPLPEHKPKKKDRFLRRITHSFGKTARSDGASGKTLRH
AHSVSTINVTERERTLSASSSNISTTSESKKSFIKWQPNILKKALFSRSSSKLQTPG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctcgatttgtatgccatcagcagcactcggtggcccattcccactaccagccc
cactcccacttccatcaccatacccaccgccatcccaatccgccccatcaccatcacatt
tacggcgccactgacgtcagttatcggcgttatcgcaccgctggcatggtggtggccgag
ggagttatggactccgggtcgggatcgggcacgggaacgggcttggggcacttcaacgag
accccattatccgcactgggcatcgagacccgcacccagctgtcccgcatgctgaaccgc
aagaaggtgctgcgatccgaggagggctaccagcgggactggcgcggcatctcggagctg
gccaagcagaagggattcgtcgacgagaacgccaacaatcccatggatctggtgctgatc
agctggagccagcggagtccccagaccgccaaggtgggccatctggaacacttcctgggc
attatcgatcggtgggacgtctgcgacgatatccaggagaatctggccaaggacacccag
cgcttcatcatgaaacaggagcagcgacagactgctctcgtggaggcgtgtccgccgccc
cccagcgactgcttcgagaccaacaacaactacagcagcagcaacaacatcacagtgggc
caaagtgtgcagatcctcagcgacgaggaccagagatgtgtacagatgggccaaccgctg
cccagatacaacgcatgtgttctgtacgcggaggcagacatcgatcatgccaccgagatc
atgaataatctagagtctgagcgatacaatctcaggctattcctgcgccaccgcgacatg
ctaatgggcgttccgttcgagcatgtccagctatcccatttcatggccacccgctgcaat
cacctgatcgtcgtgctcacagaggagtttcttcggagtccggagaacacgtacctcgtg
aacttcacccaaaagatccagattgagaatcacactcgcaagatcataccgattctgtac
aaaacggacatgcacataccccagaccctgggcatttacacgcacatcaagtacgccggg
gactccaagttgttcaacttctgggacaagttggctcgttccctacacgatctggatgcc
ttttcgatctactccacgcgccaggtgcagactccctcgccggtggaggaatcggctccc
cgggtgaccactcccagcattcggattcagatcaacgacaaggatgtcactgatatgcca
aactacaacagctgcaaagtgccggaggcggagaccacaatcgtttcggtttccggtgac
accggctcacccctgccggagcacaagccgaagaaaaaggatcgcttcctgcgcagaatc
acgcacagctttggaaagacggcgcggagcgatggggccagcggcaagactctgcgtcat
gcccactccgtcagcaccataaatgtcacggaacgcgagaggacactcagtgccagcagc
tccaacatctccaccacgtcggagagcaagaagagcttcatcaagtggcagccgaacatc
ctgaagaaggccctattctcgcgatccagcagcaagctgcagacgccgggctga

DBGET integrated database retrieval system