KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2125Help
Entry
Dmel_CG2125       CDS       T00030                                 

Gene name
ci
Definition
(RefSeq) cubitus interruptus, isoform A
  KO
K16799  transcriptional activator cubitus interruptus
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2125 (ci)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG2125 (ci)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    Dmel_CG2125 (ci)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_aberr
Motif
Other DBs
NCBI-GeneID: 43767
NCBI-ProteinID: NP_524617
FlyBase: FBgn0004859
UniProt: P19538 H5V858
Position
4
AA seq 1397 aa AA seqDB search
MDAYALPTYFPLAYSELQFLASRRAAAVAAAATVLPGSPCINQHHPTDVSSSVTVPSIIP
TGGTSDSIKTSIQPQICNENTLLGNAGHQHNHQPQHVHNINVTGQPHDFHPAYRIPGYME
QLYSLQRTNSASSFHDPYVNCASAFHLAGLGLGSADFLGSRGLSSLGELHNAAVAAAAAG
SLASTDFHFSVDGNRRLGSPRPPGGSIRASISRKRALSSSPYSDSFDINSMIRFSPNSLA
TIMNGSRGSSAASGSYGHISATALNPMSHVHSTRLQQIQAHLLRASAGLLNPMTPQQVAA
SGFSIGHMPTSASLRVNDVHPNLSDSHIQITTSPTVTKDVSQVPAAAFSLKNLDDAREKK
GPFKDVVPEQPSSTSGGVAQVEADSASSQLSDRCYNNVVNNITGIPGDVKVNSRLDEYIN
CGSISIPSNEYDCANADTTDIKDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTN
KKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRS
HTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVK
TVHGAEFYANKKHKGLPLNDANSRLQQNNSRHNLQEHNIDSSPCSEDSHLGKMLGTSSPS
IKSESDISSSNHHLVNGVRASDSLLTYSPDDLAENLNLDDGWNCDDDVDVADLPIVLRAM
VNIGNGNASASTIGGSVLARQRFRGRLQTKGINSSTIMLCNIPESNRTFGISELNQRITE
LKMEPGTDAEIKIPKLPNTTIGGYTEDPLQNQTSFRNTVSNKQGTVSGSIQGQFRRDSQN
STASTYYGSMQSRRSSQSSQVSSIPTMRPNPSCNSTASFYDPISPGCSRRSSQMSNGANC
NSFTSTSGLPVLNKESNKSLNACINKPNIGVQGVGIYNSSLPPPPSSHLIATNLKRLQRK
DSEYHNFTSGRFSVPSYMHSLHIKNNKPVGENEFDKAIASNARRQTDPVPNINLDPLTNI
SRFSTTPHSFDINVGKTNNIASSINKDNLRKDLFTVSIKADMAMTSDQHPNERINLDEVE
ELILPDEMLQYLNLVKDDTNHLEKEHQAVPVGSNVSETIASNHYREQSNIYYTNKQILTP
PSNVDIQPNTTKFTVQDKFAMTAVGGSFSQRELSTLAVPNEHGHAKCESFHHQSQKYMNT
DIGSKQQSALPSAHQRQTEKSNYNQIIDSSMTSLPELNVDSIYPRNETENIFKVHGDHDN
EIQCGIISQSQMSPSTNLNNDGQFSTVNMQPITTSKLFPPEPQKIVCDTQASNTSVMHLD
TYQRTLEYVQSCQNWMETNNTSTNQIQSLPGMPVNNTLFPDVSSSTHPYHGTNMVINDMT
TSLTSLLEENRYLQMMQ
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggacgcctacgcgttacctacatattttcctcttgcgtattctgaattgcagttttta
gcgtccaggagagcagctgccgtcgctgcagcggctactgttttaccaggatcaccatgc
ataaaccaacatcacccaactgacgtttcaagctcggtaacagtgccatcaattattcca
acgggtggaacatcagattcaattaaaacttcaatacaaccacaaatatgcaatgaaaac
acccttcttggaaatgctggccaccagcacaatcatcagcctcaacatgttcacaatata
aatgttactggacagccacatgactttcacccggcctatagaattcccggatacatggaa
cagttgtattctcttcaacgaactaattcagcttcatcttttcacgatccctatgtcaat
tgtgcatcagcattccatcttgccggacttggtttgggatcagctgattttttgggcagc
cgaggtttgagctctttgggtgaactgcataatgctgctgtggcagcagcagcagccgga
tctctcgcaagtactgattttcacttcagtgttgatggaaacaggcggttgggtagccct
cgaccaccaggaggaagtatacgtgccagcataagccgcaaacgagcactttcgtcatcg
ccttattccgattcatttgatattaattcaatgattcgattttcgccaaactctttagcc
acaattatgaacggttctcgaggaagcagcgcggctagtggttcttacggtcatatttct
gctaccgcccttaatcccatgtctcatgttcattcaacccgtctgcaacagatacaagct
catttattgcgtgcaagtgcaggtctgttaaatccgatgacaccacaacaagttgctgca
tctggattttctatagggcatatgccaacctctgcttctttgagagtgaatgacgtacat
cctaatctaagcgattcacatatccagataacaacatccccaactgttacaaaggatgta
agccaggtcccagcggcagcattctcgttgaagaacttagatgatgcaagagagaaaaag
ggaccctttaaagatgttgtccccgagcagccttcatcgacatctggcggcgtagcacaa
gtagaagccgacagtgcgtcttcacagttgtctgaccgttgttacaacaacgtggtaaac
aatattacaggcattcctggtgacgttaaagtaaacagccgcttggatgagtatattaat
tgcggatcaatttcgattccgtcaaatgaatatgattgtgctaatgctgatactacggat
atcaaggatgaacccggagatttcattgaaacaaattgtcattggcgtagctgtcgcatt
gagttcattacgcaagatgaacttgttaaacatataaataatgatcatattcaaacaaac
aagaaagcttttgtctgtcgatgggaagattgtacacgcggtgaaaaaccatttaaagcg
cagtatatgcttgttgtgcatatgcggcgtcataccggtgaaaagccacacaaatgcacg
tttgaaggctgctttaaggcatattcacgtttggaaaacctgaaaactcatttacggtca
cacacaggagaaaaaccatacacttgcgagtatccgggatgtagcaaagcctttagtaat
gctagtgatcgcgcaaagcatcaaaatcgaacacacagtaatgagaaaccgtacatttgt
aaagcacctggatgcacaaaacgttacaccgacccgagctctttgagaaaacatgtaaaa
acagtccatggagctgaattttatgcaaataaaaaacataaggggttgcctctaaatgac
gcaaactctcggttacaacaaaacaacagtcggcataatcttcaagagcacaatatcgac
tcaagcccttgcagtgaagactcacatttgggaaaaatgttaggcacgtctagtcctagc
attaaatctgaatcagatataagctcatcaaaccatcacttagtaaatggagttcgagca
tctgacagtttgttaacatattcacctgatgatcttgctgaaaatcttaatttggatgat
ggctggaattgtgacgatgacgtggacgtggcagacctaccaattgtgttacgtgctatg
gtaaatattggtaacggaaatgcatccgcctcgactattggaggttctgttttggctagg
caacggtttagaggtcgtcttcaaactaaaggtataaattcaagtacgattatgctttgc
aacattccagaaagcaatcgtacctttggaattagcgaacttaatcagcgtattacagaa
ctgaaaatggagccaggtactgatgctgaaattaaaattcctaagctcccaaacacgacc
ataggaggatatacggaagaccctttacaaaaccaaacaagttttcgtaatacagtatcg
aataagcaaggaactgtttccggatcgatacaaggacagtttcgtcgcgatagtcaaaat
tccactgcaagcacttattacggtagcatgcaaagtcgtcgtagcagtcaatcatcccag
gtgtcttctatacctaccatgcgaccgaacccctcgtgtaactcgactgcatccttttat
gatcccatttcaccagggtgctcacggcgctctagccaaatgtcaaatggtgctaactgc
aattcatttacttccacatcaggactacccgtattaaataaggaatcgaacaaaagctta
aatgcatgtattaataaacctaatatcggggttcagggtgttggaatttacaatagcagt
ctacccccacctccatcgtcccacttaattgcaacaaacttaaagcgcttacagcggaaa
gattcagaatatcacaatttcactagcgggcgattttctgttcctagttatatgcattct
ttacacataaaaaacaacaaaccagtcggagaaaacgaatttgataaagcaatagcgagt
aatgcacgacgtcaaactgatccagtgccaaacataaacttagatccattaacaaatatt
tctcggttcagtacaacaccgcatagctttgatattaatgtcggaaagactaataatata
gcatcgtcaattaataaggacaatttaagaaaggatctgttcactgtttcaattaaggct
gacatggcaatgactagtgaccaacatccaaatgaaagaataaatttggacgaagttgaa
gaacttatacttcccgatgaaatgcttcagtacttaaacttggtaaaagacgacacaaat
catttggaaaaagaacatcaagctgtacctgtggggtcaaatgtatccgaaactatagct
tcaaaccactaccgagaacaatcaaatatatattacaccaataaacaaattttaacaccg
ccttctaacgttgatatacaaccaaatacaacaaagtttacagtacaagacaaatttgct
atgacggcggtcgggggttcattcagtcaaagagaattaagtaccctagctgtaccaaat
gaacatgggcatgccaaatgcgaaagcttccatcaccagtctcaaaaatatatgaacact
gacattggctccaagcagcaatcagcattaccgtcagctcatcaacggcaaacagaaaaa
tcaaattataatcaaatcatagactcatcgatgactagcttgccagaacttaatgtagat
tcaatatatccacgaaacgaaacagaaaatatatttaaagtacacggagatcatgataat
gaaatccaatgcggcattataagtcaatctcaaatgtcaccttccactaatttgaataat
gatggtcagttttctaccgtaaatatgcaaccaataacaacatccaaattatttccccct
gaaccacaaaaaatagtttgtgacacccaagcgagtaatacttcggttatgcatttagat
acatatcagcgtactctggaatatgtacaaagttgtcaaaactggatggagacgaacaac
acatctaccaatcaaatacaaagcctcccgggaatgccggtaaacaatacattgtttccc
gatgttagcagctctacacatccatatcatgggacaaatatggtgatcaacgatatgact
acatcccttacttccttactcgaggaaaatagataccttcaaatgatgcagtaa

DBGET integrated database retrieval system