KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2184
Entry
Dmel_CG2184       CDS       T00030                                 

Symbol
Mlc2
Name
(RefSeq) myosin light chain 2
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 Caleosin EF-hand_8
Other DBs
NCBI-GeneID: 43587
NCBI-ProteinID: NP_524586
FlyBase: FBgn0002773
UniProt: P18432
Position
3R
AA seq 222 aa
MADEKKKVKKKKTKEEGGTSETASEAASEAATPAPAATPAPAASATGSKRASGGSRGSRK
SKRAGSSVFSVFSQKQIAEFKEAFQLMDADKDGIIGKNDLRAAFDSVGKIANDKELDAML
GEASGPINFTQLLTLFANRMATSGANDEDEVVIAAFKTFDNDGLIDGDKFREMLMNFGDK
FTMKEVDDAYDQMVIDDKNQIDTAALIEMLTGKGEEEEEEAA
NT seq 669 nt   +upstreamnt  +downstreamnt
atggccgatgagaagaagaaggttaagaagaagaagaccaaggaagagggtggtacttcc
gaaaccgcttctgaggccgcatccgaggcagcaaccccggcaccagctgccactcctgcc
ccggccgcatctgccactggttcgaagagagcgtcgggcggatcccgtggctccaggaag
tcgaagcgcgctggctcctcggtcttctctgtgttctcccagaagcagatcgccgagttc
aaggaggccttccaactcatggatgccgacaaggacggtattattggcaagaacgatctg
cgcgctgccttcgactccgtcggcaagatcgccaacgacaaggagttggacgccatgctg
ggcgaggcctcgggtccgatcaacttcacccagttgctgaccctgttcgccaaccgcatg
gccacctccggtgccaacgatgaagacgaagttgttattgctgccttcaaaacattcgat
aacgatggtctcatcgacggtgacaaattccgcgaaatgctcatgaacttcggtgacaag
ttcaccatgaaggaggttgatgatgcctacgatcagatggtgatcgacgacaagaaccag
atcgataccgccgccctgatcgagatgctcaccggcaagggtgaagaggaggaggaggag
gccgcctaa

DBGET integrated database retrieval system