KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2238
Entry
Dmel_CG2238       CDS       T00030                                 

Gene name
eEF2
Definition
(RefSeq) eukaryotic translation elongation factor 2, isoform A
  KO
K03234  elongation factor 2
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dme03012]
    Dmel_CG2238 (eEF2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG2238 (eEF2)
Translation factors [BR:dme03012]
 Eukaryotic type
  Elongation factors
   Dmel_CG2238 (eEF2)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG2238 (eEF2)
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_III GTP_EFTU_D2 MMR_HSR1 PAP_assoc
Other DBs
NCBI-GeneID: 35422
NCBI-ProteinID: NP_525105
FlyBase: FBgn0000559
UniProt: P13060
Position
2L
AA seq 844 aa
MVNFTVDEIRGLMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTR
KDEQERCITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVT
AALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQ
TFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFK
IDVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFDAIMNYKKEEIGT
LLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYE
GPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVFAGKVATGQKCRIMGPNY
TPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKDAHNM
KVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHL
EICLKDLEEDHACIPLKKSDPVVSYRETVSEESDQMCLSKSPNKHNRLLMKALPMPDGLP
EDIDNGDVSAKDEFKARARYLSEKYDYDVTEARKIWCFGPDGTGPNFILDCTKSVQYLNE
IKDSVVAGFQWASKEGILADENLRGVRFNIYDVTLHADAIHRGGGQIIPTTRRCLYAAAI
TAKPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEENQVVGTPMFVVKAYLPVNESF
GFTADLRSNTGGQAFPQCVFDHWQVLPGDPSEPSSKPYAIVQDTRKRKGLKEGLPDLSQY
LDKL
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggtcaacttcaccgtcgacgagatccgtggcctcatggacaagaagcggaacatccgc
aacatgtctgtgattgcccacgtagaccacggcaagtccactctgaccgattcccttgtg
tcgaaggctggtatcattgccggagccaaggctggtgagactcgtttcactgacacccgc
aaggacgagcaggagcgctgcattaccatcaagtcgactgccatttccatgtactttgag
gtggaggaaaaggatctggtgttcattacccaccccgatcagcgcgagaaggagtgcaag
ggtttcctgatcaacttgatcgactcgcccggtcacgttgacttctcctcggaggtgacc
gccgcccttcgtgtaaccgacggtgcactcgttgttgtagactgcgtctccggagtttgt
gtccagaccgaaaccgtgctgcgtcaggccatcgctgagcgtattaagcccatcctattc
atgaacaaaatggaccgcgctctgcttgagctgcaactagatgccgaggagctgtaccag
accttccagcgcatcgtcgagaacgtaaacgttatcattgccacctataacgatgacgga
ggaccgatgggtgaggttcgcgtggatccctctaagggatcagtgggcttcggttctggg
cttcacggctgggcgttcaccctcaagcagttctctgagatgtactccgagaaattcaag
attgatgttgtcaagctaatgaaccgattgtggggtgaaaacttctttaacgccaagacc
aagaaatggcagaaacagaaagaggctgacaacaaacgctcgttctgcatgtacatcctg
gaccccatctacaaggtgttcgatgccattatgaattacaagaaggaggagataggtacc
ttgctcgagaaaatcggtgtgactctgaagcatgaagacaaggacaaagatggcaaagct
ctgctgaagactgtgatgcgcacctggctgccagccggcgaggctttacttcagatgatt
gctattcatttgccgtcgccagtggttgcccagaagtaccgcatggagatgctgtacgaa
ggtccccatgacgatgaggccgctatcgccgttaagtcttgcgatcctgatggtcctcta
atgatgtacatttctaagatggtaccgacctctgacaagggtcgcttctatgctttcggt
cgtgtgttcgccggtaaggtggccaccgggcaaaagtgccgaatcatgggccccaactac
actcccggcaagaaggaggacttatatgagaaggctattcagcgcacaattctcatgatg
ggtcgttacgtcgaggccatcgaggatgtgccctctggcaacatttgcggtctggtcggt
gttgatcagttcttggttaagaccggtacgattaccaccttcaaggacgcccacaacatg
aaggtcatgaagttctccgtgtcccctgtggtgcgcgtggctgttgagccaaagaacccc
gcggacttgcctaagctggtggagggcttgaagcgtttggctaagtccgatcctatggtg
cagtgtatcatcgaagagtccggcgagcatatcattgctggtgccggtgagctgcatttg
gagatctgccttaaggatctagaggaagaccacgcttgtatcccactgaagaagtctgat
cccgtcgtctcctaccgtgagactgtgtcggaggagtccgaccagatgtgtctgtccaag
tcgcccaacaagcacaaccgtctgctgatgaaagccctacctatgccagacggtcttccc
gaggacattgataacggcgatgtgagtgccaaggatgagttcaaggctcgtgcccgttat
ttgtctgagaagtacgactacgatgtgactgaggcccgtaagatctggtgcttcggcccc
gacggaaccggtccgaatttcatcctcgactgtaccaagtccgtgcagtaccttaacgaa
atcaaggactctgttgtcgctggattccaatgggcctcaaaggagggtattttagccgac
gaaaacttgcgcggtgtccgcttcaacatctacgatgtgacacttcacgctgatgccatc
catcgtggtggtggccagatcattccaaccactcgtcgttgtctgtacgctgccgctata
accgccaagccgcgcctgatggagcctgtttacctgtgcgagatccagtgccccgaggtt
gctgtaggaggaatatacggtgtgctcaacaggcgacgtggccatgtattcgaggaaaac
caggttgtgggcactcccatgttcgttgtgaaggcatacctgcccgtcaacgagtcattc
ggttttaccgccgatctgcgctctaataccggaggacaggccttccctcaatgtgtcttc
gatcattggcaggtgttgcctggcgatccgagcgagccctcaagcaagccctatgccatc
gtccaggatactcgtaagcgcaagggtcttaaggaaggattgcccgatctatcccagtac
ttggacaagttgtaa

DBGET integrated database retrieval system