KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2247
Entry
Dmel_CG2247       CDS       T00030                                 

Gene name
CG2247
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: F-box F-box-like LRR_4
Other DBs
NCBI-GeneID: 32111
NCBI-ProteinID: NP_001245625
FlyBase: FBgn0030320
UniProt: Q9VYW5
Position
X
AA seq 1048 aa
MDVPDDNFGPSKPCDKQPLAGNSSSATNSSSHTGGNGNVDSAFESSTAAGPSSGANQSST
GGAIDEQGSIGEQSAGVGQNIIEGDLLVLNANSTNVDLSTHRDGSSFKDSNTEQGKKSTM
IKTSKTLNDKSQFERRRRRGRQRERHREPSTHRDDLEPCDLGLMGWTGEFPKLTPISNIE
SNSDKEPLSTAKPGVLPWSGLKVFPRVEPQEETAAGTTKPAHITNKSEEQQQQPSLTTPI
MTSPLDASQGELDAAIKSPLNAKKSPNATGIATTSKSSTTPTNMQPSDLYNQVEDKKEDT
TKKQAEADHTLHKSLKDARIVKRSMSTHSPPEHSRRSVRFSSHTPLTDETNIMKETSTET
SLKVIFERLKQTGVERDLFIPSSENPRPRSNGSPVPKVAEMEHVAVVKCKTVAKQGAVVK
GKAGLANPSNVMPQTPALTVTGKRVSKPKVPKGASPPSEGWTSTRAVKGNSRADYTNSSS
CGSPIGNTNIRRRRAHAKAAPDKSKPCVRCAASVHPSGPKLCKKCIYEKGYANKKWMKKT
GGNEDHYDDDDDSDFSMIEVTLENEISVQQAEKKQLENVNKQTVIKEQEVVVIGGRKAIA
IIADPIGCNLKVIPNRQNLAGLKKISKDKCSSSLVQSLGDCHIGCQIVMAVMKIMTMKDR
VNMAQVCKTWAMISQDKSVWRTVMLRDTHISNWPRFIRELANNCTRELDMLGVILPNPPD
ILATLDISVLKALRVLRTCPVDDQFLFKVFRELPQLLELRAICYSPTFNFLNLARQWSKI
RVLQILMTDHRSKVESLDSLGDLVHLTELNIRGVNYIGSQDFRFLKKLVNLKVLVLSSCQ
GMDTEEFGQQVLPFLTSLRRLRLENKHMINTTFPLYHIMCGVAAACSVQQLELVNVEVDD
LLTSLIGMCTTVTHLLLVPKCLQNSANVIYSVMRAVRENASQLRVFRLGLVTQLLSATGE
LYRGSKKDVIPVERPVPGIPLDDDLNYCAPDDRCIETDHTECVTFLPAKRLLMILRDVAP
TTFVTFVKVNMFNSTMVTFLKRPQLKNK
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggatgtgcccgatgacaattttgggccgtcaaagccgtgtgacaagcagcccttagct
ggcaactctagcagcgctaccaattcatcgtcgcataccggtggtaacggtaacgttgat
tccgcattcgaatcatctacagctgcaggacctagttccggcgccaatcaaagtagcaca
ggcggtgctatagatgaacaaggttccattggtgaacagagtgccggcgtgggacaaaac
attattgagggcgacttgctggtgttaaatgccaattccacaaacgtggatctttcgact
caccgggatggctctagctttaaagactcgaacactgagcagggaaaaaaaagtactatg
attaagacttcaaagacattaaatgacaagagtcaatttgaacgccgcagacgccgtggc
cgtcaacgtgaacgtcatcgtgagcccagcacgcatcgtgacgatcttgaaccgtgcgat
ttaggtctaatgggatggactggagaattcccaaagctaacacccatatccaacatcgaa
agcaactcggataaagaaccgctgtcgacggccaagccaggtgtactgccatggagtggc
ctaaaggtttttccgagagtggaaccacaagaggagacagcggcaggtacaacaaagccg
gctcatatcactaataagtctgaggagcagcagcagcagccgtctctaacaacgccgata
atgacgtcgccactcgacgcctcccagggggaattggatgcagccattaaaagccctttg
aacgcaaaaaaaagtccaaatgcaactggtattgcaacaacatccaagtccagtacaaca
ccaaccaacatgcaaccatcagacttatacaaccaggttgaagataaaaaagaggatacc
accaagaagcaggcggaagctgatcataccttgcacaaatcacttaaggacgctcgcatc
gtaaaacgttctatgtccacccattcgcctccggagcattcgcgtcgttcagtgcgcttc
agtagccatacgcctctgaccgatgagacgaacataatgaaagaaacatccaccgaaacc
tctttgaaagttattttcgaacgcctaaagcaaactggcgtagagcgagatctctttata
cccagctccgaaaatcccaggcctcgcagcaatggtagcccggtcccaaaggtggcggag
atggaacatgtggcggttgtgaagtgcaaaacggtggcgaagcaaggggcggtggtgaaa
ggcaaggctgggttggccaacccgtccaacgtaatgccccagacgcctgccttaacggtc
actggaaagcgagtgtcgaagcccaaggtgcccaaaggggcaagtccaccgagtgagggc
tggacctcgaccagggcggttaaggggaattctcgggcagactacaccaacagcagctcg
tgcggttcaccgattggtaataccaacattcgcaggcgcagagctcacgcaaaggcagcc
cctgataagtcaaagccttgtgtgcgctgcgcggcttctgttcatccgtctggacctaag
ttgtgcaagaagtgtatctatgagaagggatatgccaataagaaatggatgaaaaagact
ggaggaaatgaggatcattatgatgatgacgatgacagtgacttcagcatgatagaagtc
actttggaaaatgaaatatccgttcaacaggcggagaaaaagcagttagaaaacgtgaat
aagcagaccgttataaaggaacaagaggttgttgtaattggagggcgcaaggctatagcc
atcatagccgatccgattggttgcaatctgaaagtgattccaaaccggcagaatttggct
ggccttaaaaagatctcaaaggacaaatgtagctccagtttggtgcagagcctgggcgat
tgtcacatcggatgccagatagtgatggccgttatgaaaatcatgacgatgaaggatcgt
gtaaatatggcgcaggtttgcaaaacatgggccatgatcagtcaggataagagtgtatgg
cgcacagtcatgctacgcgatacccatatcagcaactggccgcgatttatccgtgaactc
gcaaataattgcacacgcgaactggacatgctgggcgtgatattgccgaatcctccggat
attctcgctacactcgacattagcgtcctgaaagcattgcgtgttcttcgcacttgtcca
gtagatgaccagttcctctttaaggtctttcgtgaattgccccaactgctggagctaagg
gcaatctgctacagtccaacttttaattttttaaatttggcacgacaatggtctaagatt
cgcgtgcttcaaatcttaatgacggaccacagaagcaaagtggaatcactagactctctg
ggcgacctggtgcatctaactgagttgaatatacgtggagtgaattatataggctcgcag
gacttccgcttcttgaagaaactagttaacctgaaggtgctagtgttgtcttcatgccag
ggcatggataccgaggaatttggccagcaagtgctgccctttttaacgtctctacgcagg
ctccgcttggagaacaagcacatgatcaataccacttttccgctgtaccacattatgtgt
ggtgtagccgctgcttgttcggtacagcaactggagctggtgaacgtcgaggtggatgac
cttctaacttcgttgattggaatgtgcaccactgttacgcacctgttgctcgtcccaaag
tgtcttcaaaattcggccaacgtgatctattccgtaatgcgggccgttcgcgagaatgcc
tcgcagcttcgcgtgttccgcctaggattggttacccagctgttgagtgcaacgggtgag
ctgtacaggggaagtaagaaggatgtgatccccgtggagcgccctgtaccgggaattccg
ctggacgatgaccttaattattgtgctcccgatgaccgttgcattgaaacggaccacacg
gaatgcgttacctttctgcccgccaagcgcttgctgatgatactgcgcgatgtggcacca
acaacatttgttacgtttgttaaggtgaacatgttcaacagcaccatggttaccttcctc
aaacggccacagttgaaaaacaagtaa

DBGET integrated database retrieval system