KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2262Help
Entry
Dmel_CG2262       CDS       T00030                                 

Gene name
Smox
Definition
(RefSeq) smad on X, isoform B
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04068  FoxO signaling pathway
dme04144  Endocytosis
dme04350  TGF-beta signaling pathway
dme04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dmel_CG2262 (Smox)
   04068 FoxO signaling pathway
    Dmel_CG2262 (Smox)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG2262 (Smox)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG2262 (Smox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 31738
NCBI-ProteinID: NP_001285006
FlyBase: FBgn0025800
UniProt: O96660
Position
X
AA seq 486 aa AA seqDB search
MLPFTPQVVKRLLALKKGNEDNSVEGKWSEKAVKNLVKKIKKNSQLEELERAISTQNCQT
RCVTVPRSKPAPAGEHLRKGLPHVIYCRLWRWPDLQSQNELKPLDHCEYAFHLRKEEICI
NPYHYKKIELSILVPKSLPTPPDSIVDYPLDNHTHQIPNNTDYNAAIIRSASLSPPQYME
LGGAGPVSVSSSASSTPATAAGGGGGPSSSSSSSSSAASAYQQQQQQLSFGQNMDSQSSV
LSVGSSIPNTGTPPPGYMSEDGDPIDPNDNMNMSRLTPPADAAPVMYHEPAFWCSISYYE
LNTRVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNRNEVVEQTRRHIGKGVRLYYI
GGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLSQSVSQG
FEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDRVLTQMGSPRL
PCSSMS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattcaccccgcaggtggtcaagcgtttgttagcactcaaaaagggcaacgag
gacaacagcgtcgagggcaagtggtcagagaaggccgtcaagaatctggtcaagaagatc
aagaagaattcgcagctggaggagctagagcgcgcgatctccacacagaactgccagacg
cggtgcgtgacggtgccgcgcagcaagccagctcccgccggcgagcatctgcgcaagggt
ctgccgcacgtcatctattgccgcctgtggcgctggcccgatctccagagtcagaatgaa
ctaaagcccctcgatcattgcgagtacgccttccatttgcgcaaggaggagatctgcata
aatccgtaccactacaaaaaaattgaactgtccatcctggtgcccaaatcgctgcccacg
ccgcccgactccattgtggactatccgctggacaaccatacgcaccagatacccaacaac
accgattacaatgcggcgatcattcgcagcgcctcgttgagtccgccgcagtacatggaa
ttgggcggtgccgggcccgtttccgtatcatcgtctgccagttcgacgccagcgactgcc
gccggtggtggtggtggtccctcctcgtcgtcgtcgtcgtcatcgtccgccgcctccgcc
tatcaacagcaacagcagcagctgtcctttggccaaaacatggactctcaatcgagtgtg
cttagtgtgggcagcagcattcccaacaccggcaccccgccgcccggctatatgagcgag
gatggtgaccccatcgatcctaacgacaacatgaacatgtcgcgtctaacgccgcccgcc
gatgcagcgccggtgatgtaccacgagccggccttttggtgttccatctcctactatgag
ctaaatacgcgtgtcggcgagacgttccatgcctcgcagccctcgatcacggtggatggc
tttaccgatccctccaattcggagcgcttttgcctcggactgctgtctaatgtgaatcgc
aacgaggtcgtggagcagacacgtcgccacatcggcaagggcgtacggctttactatatt
ggcggtgaggtattcgcagaatgtctgagcgattcgtccattttcgtacagagcccaaat
tgtaatcagcgatatggctggcatccggccaccgtatgcaagataccgcccggttgcaac
ctaaagatcttcaacaaccaggagtttgccgccctgctgtcgcagtccgtgtcgcaggga
ttcgaagcggtctaccaattgacacgcatgtgcaccatccgcatgtcgttcgtcaagggc
tggggcgccgaatatcgccgccagacggtgacctcaacgccctgctggatcgaactccat
ctgaacgggccgctccagtggctggatcgcgtgctcacacagatgggttcgccacggctg
ccgtgcagctccatgtcataa

DBGET integrated database retrieval system