KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2292
Entry
Dmel_CG2292       CDS       T00030                                 

Gene name
PIG-N
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class N
  KO
K05285  GPI ethanolamine phosphate transferase 1 [EC:2.7.-.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    Dmel_CG2292 (PIG-N)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     Dmel_CG2292 (PIG-N)
SSDB
Motif
Pfam: PigN Phosphodiest RNA_pol_I_A49 Sulfatase Metalloenzyme
Other DBs
NCBI-GeneID: 36049
NCBI-ProteinID: NP_610549
FlyBase: FBgn0033479
UniProt: A1Z838
Position
2R
AA seq 894 aa
MWIAYALVVHVLLLGSIFVIYFRSPVITGLTPQKHLLYYGLEPPANRLVLIVTDGFRADS
FFEENCRYVPNLRKIFLREGVVGVSRTRVPTETRPGHITLIAGLYEDPSAVLRGWKSNPI
DFDTVFNRSSQTYAWGANDVLNVFSHVSNGGEINLRFYNHDLDFSPGYDAYEEDEWVFKR
VKLLLQQKREALQRAQNVVFFLHLLGLDTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFE
RVFPDKRTAYLLTADHGMTDSGAHGSGSPHETDTPFMLWGAGASRAVPKPGGRTFMPNNE
GPAMPLHELEQAQLTPLMSALLGLAPPMNNFGKLPLGYLNVSKEYEAMAAHVNALQLLEQ
YVALQKQHKKGFFADILLEYDVLNAEAIKRYKDTIVQLQKKREYSLCIDKSQVIMSQALE
GIDYYHGYYRRVLLLSTTSTFLGWMFYIYRLLSRNRASKVELVLERSNKIVRVSIVSSVI
VLIICLLSQGTPLDISFYLLLPYFVWLKALQPWNINFSSSPASAYSVPALQTSMWQLVLL
IACAELMVFTFFERRLIALCFCVFACYNSWENFQWKSRDFFSWLALVLILSCFPLLPLSV
GYQNGYLLGAGVIVIFTNSFWNSKSRLCYRNHTKYSNALILLQTILCAYLHSNGINIPIP
LKLASWLYLVYAFASILLSKESRLDLRLAQIGFNLGSLYATLCTSYEAVFVQLLTIELNI
SLRAQSARAERSVLRLAFTLLLYTFFSLFGSGNIASISSFDPNIARCYLSHFAPFVIMGL
VLLKLLVPVVLIMSVIYANSEFVRQHEEQIFICLLLICDVMGLNFLFLVRNQGSWLDIGT
SISHFVIMEVTTLVMLVIFYTAKQLLRVIPWEEIDFKMLPLRLIHWDVISAKHH
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgtggattgcttacgccctggtggtccacgtactgcttctaggctcaattttcgtgatc
tactttcgttcgccggtgatcacgggccttactccacagaagcatcttttatattacggc
ttggagccaccggcgaatcgtttagtgctgatcgtgaccgatggattccgtgccgactcc
ttctttgaggagaactgccgctatgtgcccaacctgcgcaagatcttcttgcgggagggc
gtcgtgggcgtgtcacgcactcgtgtgccaacggaaacccgtcccggacacatcacccta
attgccggactctacgaggatccatcggcagtgctgcgcggctggaaaagtaatcccatc
gatttcgacaccgtattcaaccgaagctcacagacctacgcatggggcgcgaacgatgtt
ctcaatgtgttttcccatgtgtccaacggtggcgaaataaatctccggttctacaaccac
gatctggacttttcgccaggctacgatgcctacgaggaagacgagtgggttttcaaaagg
gtgaagttgttgctccagcagaagagagaagccctgcagcgggcacagaacgtcgtgttt
tttctgcacctccttggactggacaccgctggacatgtccacaagccaggcgcgccaaag
tttcgacggaccttggaaaagacggaaaaaggtgtttacgcaatataccaggagttcgag
cgggtgtttcccgataagcgaactgcttacttgttgaccgcggatcatggaatgacggat
tcgggtgcccacggttctggttcgccccatgaaacggacaccccttttatgctctggggt
gcaggagcctcgcgggccgttcccaaacctggagggcgaacatttatgcccaacaatgag
ggtcctgcaatgccactgcacgaattggagcaagcccaacttacacccctgatgtccgcg
ttgttgggtctcgcaccgcccatgaacaactttgggaagttgccgttgggttacttgaat
gtcagcaaggaatacgaggcaatggctgcccatgtaaacgctctgcagctactagaacag
tatgtggccctgcaaaagcagcataaaaagggatttttcgcggatattttactcgagtat
gatgttttaaacgccgaagcgatcaaacgatacaaggatactatcgtacagctgcagaag
aagagggagtattcactttgtatagacaagagccaagtcatcatgtcgcaagccctcgag
ggcatcgattactatcacggatactaccgtagagtgcttttactgagcaccacttccaca
ttcctgggatggatgttctacatctaccgccttctgtctaggaacagggccagtaaagtg
gaattggtcctcgaaaggagtaacaaaatagtcagagtgagcatagttagttcagtgatc
gtgctcattatttgtttgctgagccaaggaacaccactggatatatccttttatctgctg
cttccatatttcgtttggcttaaggctttgcaaccttggaacattaacttctcttcatcg
ccagcttcagcgtatagtgtgccggccctgcagacctcaatgtggcagcttgtgttactc
atcgcttgcgcagagctaatggtctttaccttcttcgagcgccgcctcatcgcgctgtgc
ttctgcgtctttgcctgctacaatagctgggaaaattttcaatggaaatccagggatttc
ttttcctggctggcattggtcctgattctgtcatgctttccgctgctgccgctgtcagtg
ggctaccaaaatggatacctgcttggagctggagttatagtcatttttacgaactcattt
tggaattctaagtcgagattatgctacaggaaccacacaaagtactctaatgccttgata
ctgctgcaaactatattgtgtgcttatcttcactcaaacggcattaatataccaattcca
ttgaaattggctagctggttgtacctggtatacgcctttgcatctatattgctgagcaaa
gaatcaagactggatttgcgtctcgcccagattggctttaatttgggatctctctacgca
acactatgtacgtcctatgaggctgtgttcgttcaattgctgactatagagctgaatatc
tcgttgagggctcaaagtgcgcgggcagagagatcagttctccgtctggccttcaccctg
ctattgtacaccttcttttcgctctttggatccggaaacatagcgtcaatcagctccttt
gatccgaacatcgctcgctgctacctcagtcattttgctccctttgtaatcatgggtctg
gtgctactgaaactactcgttcctgtggtgcttatcatgtcggtgatctatgccaacagc
gagtttgtacgccagcacgaggagcagatcttcatctgtctgctgctcatttgcgatgta
atgggcctgaacttcctattcctggtacggaaccagggctcctggctggacatcggtacg
tccatatcacacttcgttatcatggaggtaaccacgctggtgatgctcgtgatcttctat
accgcaaagcagctgctgcgagtgattccttgggaggaaatagacttcaaaatgttgccg
ctgcgtttaatccactgggatgtgatcagcgccaaacatcactag

DBGET integrated database retrieval system