KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2411Help
Entry
Dmel_CG2411       CDS       T00030                                 

Gene name
ptc
Definition
(RefSeq) patched
  KO
K06225  patched 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    Dmel_CG2411 (ptc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patched Sterol-sensing MMPL
Motif
Other DBs
NCBI-GeneID: 35851
NCBI-ProteinID: NP_523661
FlyBase: FBgn0003892
UniProt: P18502
Position
2R
AA seq 1286 aa AA seqDB search
MDRDSLPRVPDTHGDVVDEKLFSDLYIRTSWVDAQVALDQIDKGKARGSRTAIYLRSVFQ
SHLETLGSSVQKHAGKVLFVAILVLSTFCVGLKSAQIHSKVHQLWIQEGGRLEAELAYTQ
KTIGEDESATHQLLIQTTHDPNASVLHPQALLAHLEVLVKATAVKVHLYDTEWGLRDMCN
MPSTPSFEGIYYIEQILRHLIPCSIITPLDCFWEGSQLLGPESAVVIPGLNQRLLWTTLN
PASVMQYMKQKMSEEKISFDFETVEQYMKRAAIGSGYMEKPCLNPLNPNCPDTAPNKNST
QPPDVGAILSGGCYGYAAKHMHWPEELIVGGAKRNRSGHLRKAQALQSVVQLMTEKEMYD
QWQDNYKVHHLGWTQEKAAEVLNAWQRNFSREVEQLLRKQSRIATNYDIYVFSSAALDDI
LAKFSHPSALSIVIGVAVTVLYAFCTLLRWRDPVRGQSSVGVAGVLLMCFSTAAGLGLSA
LLGIVFNAASTQVVPFLALGLGVDHIFMLTAAYAESNRREQTKLILKKVGPSILFSACST
AGSFFAAAFIPVPALKVFCLQAAIVMCSNLAAALLVFPAMISLDLRRRTAGRADIFCCCF
PVWKEQPKVAPPVLPLNNNNGRGARHPKSCNNNRVPLPAQNPLLEQRADIPGSSHSLASF
SLATFAFQHYTPFLMRSWVKFLTVMGFLAALISSLYASTRLQDGLDIIDLVPKDSNEHKF
LDAQTRLFGFYSMYAVTQGNFEYPTQQQLLRDYHDSFVRVPHVIKNDNGGLPDFWLLLFS
EWLGNLQKIFDEEYRDGRLTKECWFPNASSDAILAYKLIVQTGHVDNPVDKELVLTNRLV
NSDGIINQRAFYNYLSAWATNDVFAYGASQGKLYPEPRQYFHQPNEYDLKIPKSLPLVYA
QMPFYLHGLTDTSQIKTLIGHIRDLSVKYEGFGLPNYPSGIPFIFWEQYMTLRSSLAMIL
ACVLLAALVLVSLLLLSVWAAVLVILSVLASLAQIFGAMTLLGIKLSAIPAVILILSVGM
MLCFNVLISLGFMTSVGNRQRRVQLSMQMSLGPLVHGMLTSGVAVFMLSTSPFEFVIRHF
CWLLLVVLCVGACNSLLVFPILLSMVGPEAELVPLEHPDRISTPSPLPVRSSKRSGKSYV
VQGSRSSRGSCQKSHHHHHKDLNDPSLTTITEEPQSWKSSNSSIQMPNDWTYQPREQRPA
SYAAPPPAYHKAAAQQHHQHQGPPTTPPPPFPTAYPPELQSIVVQPEVTVETTHSDSNTT
KVTATANIKVELAMPGRAVRSYNFTS
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgacagcctcccacgcgttccggacacacacggcgatgtggtcgatgagaaa
ttattctcggatctttacatacgcaccagctgggtggacgcccaagtggcgctcgatcag
atagataagggcaaagcgcgtggcagccgcacggcgatctatctgcgatcagtattccag
tcccacctcgaaaccctcggcagctccgtgcaaaagcacgcgggcaaggtgctattcgtg
gctatcctggtgctgagcaccttctgcgtcggcctgaagagcgcccagatccactccaag
gtgcaccagctgtggatccaggagggcggccggctggaggcggaactggcctacacacag
aagacgatcggcgaggacgagtcggccacgcatcagctgctcattcagacgacccacgac
ccgaacgcctccgtcctgcatccgcaggcgctgcttgcccacctggaggtcctggtcaag
gccaccgccgtcaaggtgcacctctacgacaccgaatgggggctgcgcgacatgtgcaac
atgccgagcacgccctccttcgagggcatctactacatcgagcagatcctgcgccacctc
attccgtgctcgatcatcacgccgctggactgtttctgggagggaagccagctgttgggt
ccggaatcagcggtcgttataccaggcctcaaccaacgactcctgtggaccacactgaat
cccgcctctgtgatgcagtatatgaagcagaagatgtccgaggaaaagatcagcttcgac
ttcgagaccgtggagcagtacatgaagcgtgcggccattggcagtggctacatggagaag
ccctgcctgaacccactgaatcccaattgcccggacacggcaccgaacaagaacagcacc
cagccgccggatgtgggagccatcctgtccggaggctgctacggttatgccgcgaagcat
atgcactggccggaggaactgattgtgggcggagcgaagaggaaccgcagcggacacttg
aggaaggcccaggccctgcagtcggtggtgcagctgatgaccgagaaggaaatgtacgac
cagtggcaggacaactacaaggtgcaccatcttggatggacgcaggagaaggcagcggag
gttttgaacgcctggcagcgcaacttttcgcgggaggtggaacagctgctacgtaaacag
tcgagaattgccaccaactacgatatctacgtgttcagctcggctgcactggatgacatc
ctggccaagttctcccatcccagcgccttgtccattgtcatcggcgtggccgtcaccgtt
ttgtatgccttctgcacgctcctccgctggagggaccccgtccgtggacagagcagtgtc
ggcgtggccggagttctgctcatgtgctttagtaccgccgccggattgggattgtcagcc
ctgctcggtatcgttttcaatgccgccagcacccaggtggttccgtttttggcccttggt
ctgggcgtcgatcacatcttcatgctgaccgctgcctatgcggagagcaatcggcgggag
cagaccaagctgattctcaagaaagtgggaccgagcatcctgttcagtgcctgcagcacg
gcaggatccttctttgcggccgcctttattccggtgccggctttgaaggtattctgtctg
caggctgccatcgtaatgtgctccaatttggcagcggctctattggtttttccggccatg
atttcgttggatctacggagacgtaccgccggcagggcggacatcttctgctgctgtttt
ccggtgtggaaggaacagccgaaggtggcaccaccggtgctgccgctgaacaacaacaac
gggcgcggggcccggcatccgaagagctgcaacaacaacagggtgccgctgcccgcccag
aatcctctgctggaacagagggcagacatccctgggagcagtcactcactggcgtccttc
tctctggcaaccttcgcctttcagcactacactcccttcctcatgcgcagctgggtgaag
ttcctgaccgttatgggtttcctggcggccctcatatccagcttgtatgcctccacgcgc
cttcaggatggcctggacattattgatctggtgcccaaggacagcaacgagcacaagttc
ctggatgctcaaactcggctctttggcttctacagcatgtatgcggttacccagggcaac
tttgaatatcccacccagcagcagttgctcagggactaccatgattcctttgtgcgggtg
ccacatgtgatcaagaatgataatggtggactgccggacttctggctgctgctcttcagc
gagtggctgggtaatctgcaaaagatattcgacgaggaataccgcgacggacggctgacc
aaggagtgctggttcccaaacgccagcagcgatgccatcctggcctacaagctaatcgtg
caaaccggccatgtggacaaccccgtggacaaggaactggtgctcaccaatcgcctggtc
aacagcgatggcatcatcaaccaacgcgccttctacaactatctgtcggcatgggccacc
aacgacgtcttcgcctacggagcttctcagggcaaattgtatccggaaccgcgccagtat
tttcaccaacccaacgagtacgatcttaagatacccaagagtctgccattggtctacgct
cagatgcccttttacctccacggactaacagatacctcgcagatcaagaccctgataggt
catattcgcgacctgagcgtcaagtacgagggcttcggcctgcccaactatccatcgggc
attcccttcatcttctgggagcagtacatgaccctgcgctcctcactggccatgatcctg
gcctgcgtgctactcgccgccctggtgctggtctccctgctcctgctctccgtttgggcc
gccgttctcgtgatcctcagcgttctggcctcgctggcccagatctttggggccatgact
ctgctgggcatcaaactctcggccattccggcagtcatactcatcctcagcgtgggcatg
atgctgtgcttcaatgtgctgatatcactgggcttcatgacatccgttggcaaccgacag
cgccgcgtccagctgagcatgcagatgtccctgggaccacttgtccacggcatgctgacc
tccggagtggccgtgttcatgctctccacgtcgccctttgagtttgtgatccggcacttc
tgctggcttctgctggtggtcttatgcgttggcgcctgcaacagccttttggtgttcccc
atcctactgagcatggtgggaccggaggcggagctggtgccgctggagcatccagaccgc
atatccacgccctctccgctgcccgtgcgcagcagcaagagatcgggcaaatcctatgtg
gtgcagggatcgcgatcctcgcgaggcagctgccagaagtcgcatcaccaccaccacaaa
gaccttaatgatccatcgctgacgacgatcaccgaggagccgcagtcgtggaagtccagc
aactcgtccatccagatgcccaatgattggacctaccagccgcgggaacagcgacccgcc
tcctacgcggccccgccccccgcctatcacaaggccgccgcccagcagcaccaccagcat
cagggcccgcccacaacgcccccgcctcccttcccgacggcctatccgccggagctgcag
agcatcgtggtgcagccggaggtgacggtggagacgacgcactcggacagcaacaccacc
aaggtgacggccacggccaacatcaaggtggagctggccatgcccggcagggcggtgcgc
agctataactttacgagttag

DBGET integrated database retrieval system