KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2505Help
Entry
Dmel_CG2505       CDS       T00030                                 

Gene name
alpha-Est2
Definition
(RefSeq) alpha-Esterase-2, isoform B
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmel_CG2505 (alpha-Est2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dmel_CG2505 (alpha-Est2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 40908
NCBI-ProteinID: NP_001262345
FlyBase: FBgn0015570
UniProt: Q961N0
Position
3R
AA seq 566 aa AA seqDB search
MEVQVGWPKLIKMGAQLVGHKVQQYRLSTGHTVILDTKYGQVRGLQRKTVYDKEPYFAFE
GIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRNMLLGIVEGSEDCLHLNVYVK
ALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDYFMKKPVVFVAINYRLAALGFLSLKDPK
LDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQTRGLFHK
AIMQSGCALSEWVESPDNNWAFRLAQNLGYKGDEKDADVLSFLSKVCARQIAAIDQDVIN
LDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVGGNSFEGLFSYQLV
RKDPWALKNFHNILPREVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMFEALNIFSHRQ
IWHDTHRFILARQSYAPKTPTYLYRFDFDSPHFNQFRRLVCGDRIRGVAHADELSYLFYN
IIASKLDKSSMEYKTIERMVGMWTSFASSGNPNCPELGSAKWEAVQLKENAVEKCFNISH
DLEMRDLPESDCLAVWDTFYPRESLF
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgcaagtgggatggccaaagctgatcaagatgggagcccagttggttggccac
aaggtgcaacagtaccggctctccacgggtcacacagtgattttggacaccaagtacgga
caggtgcgcggactccaaaggaagacggtctacgacaaggagccgtactttgccttcgag
ggcattccgtacgccaagccccccgtgggtgacctccgattcagggctcctcagccaccg
gaaccctggcaaggagtgctcaactgcactaccaatcgatccaagcccatgcagaggaac
atgctcctgggaattgtcgagggcagtgaggattgtttgcatttgaacgtttatgtcaaa
gccttgaagtcggaaaaaccgctgcccgtaattgtgtggatttacggaggtggtttccaa
aagggtgaggcctccagggatatttacagtccggattacttcatgaagaagccagtggta
ttcgtcgctatcaactacaggttggcagcactaggatttctcagtctaaaggacccgaag
ctggatgttcctggcaatgcgggacttaaggaccaagtaatggctctgcgttggataagt
cagaacatcgcccacttcaatggcgaccccaacaacatcacattgatgggagaaagtgca
ggatcggcttctgtccacgtcatgatgaccacagagcaaacacgtggtctcttccataag
gctatcatgcaatcgggatgtgccctcagcgaatgggtggagagtccggataacaattgg
gcattccggctggcccagaatctgggctacaagggcgacgagaaggatgcggatgtacta
agctttcttagtaaggtttgcgcacgccagatagcggctattgatcaggacgttatcaat
ttggacgaggtgcgaagcttcctactattcgcatttggtcctgtgatagaaccctacgaa
accgaccactgtgtggtgcccaaaaggcacaaggatctgttgtccgaagcgtggggcaac
gacattcccgttattgtcggtggaaattctttcgagggcttgttttcctaccaactagta
agaaaagatccttgggccttgaaaaactttcacaacatcctgccaagggaggttagagaa
acgagcagtctggaagggcaggatctactggtgcggcgactaaagcaactctacttcaac
aacgagatgcaggaatcgatggagatgttcgaggccctgaatatattttcgcatcgccag
atttggcacgatacgcatcgctttattctcgcccgtcaatcttatgcccccaaaacgccc
acctatctatatcgttttgacttcgactccccgcacttcaatcaatttcgccgactggtg
tgcggcgatcggattcgcggagtagcccatgcggatgaactatcatacctgttctacaac
atcatagcctccaaactggataagtcatcgatggaatacaaaaccattgagagaatggtt
ggcatgtggacgtcgtttgcctccagtgggaatccaaattgcccagaactgggatctgcc
aaatgggaagccgtccagcttaaagaaaatgccgtggagaagtgcttcaacattagccac
gatcttgagatgcgagatttgccggagtccgattgcctagccgtttgggatacattttat
cccagggagtcgctcttctag

DBGET integrated database retrieval system