KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2647Help
Entry
Dmel_CG2647       CDS       T00030                                 

Gene name
per
Definition
(RefSeq) period, isoform B
  KO
K02633  period circadian protein 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    Dmel_CG2647 (per)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG2647 (per)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    Dmel_CG2647 (per)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS PAS_11 PAS_3 PAS_9 Keratin_2_head
Motif
Other DBs
NCBI-GeneID: 31251
NCBI-ProteinID: NP_001259194
FlyBase: FBgn0003068
UniProt: P07663 M9PGJ3
Structure
PDB: 

Position
X
AA seq 1218 aa AA seqDB search
MEGGESTESTHNTKVSDSAYSNSCSNSQSQRSGSSKSRLSGSHSSGSSGYGGKPSTQASS
SDMIIKRNKDKSRKKKKNKGAGQGAGQAQTLISASTSLEGRDEEKPRPSGTGCVEQQICR
ELQDQQHGEDHSEPQAIEQLQQEEEEDQSGSESEADRVEGVAKSEAAQSFPIPSPLSVTI
VPPSMGGCGGVGHAAGLDSGLAKFDKTWEAGPGKLESMTGVGAAAAGTGQRGERVKEDSF
CCVISMHDGIVLYTTPSITDVLGYPRDMWLGRSFIDFVHLKDRATFASQITTGIPIAESR
GSVPKDAKSTFCVMLRRYRGLKSGGFGVIGRPVSYEPFRLGLTFREAPEEARPDNYMVSN
GTNMLLVICATPIKSSYKVPDEILSQKSPKFAIRHTATGIISHVDSAAVSALGYLPQDLI
GRSIMDFYHHEDLSVMKETYETVMKKGQTAGASFCSKPYRFLIQNGCYVLLETEWTSFVN
PWSRKLEFVVGHHRVFQGPKQCNVFEAAPTCKLKISEEAQSRNTRIKEDIVKRLAETVSR
PSDTVKQEVSRRCQALASFMETLMDEVSRADLKLELPHENELTVSERDSVMLGEISPHHD
YYDSKSSTETPPSYNQLNYNENLLRFFNSKPVTAPAELDPPKTEPPEPRGTCVSGASGPM
SPVHEGSGGSGSSGNFTTASNIHMSSVTNTSIAGTGGTGTGTGTGTGTGTGTGTGTGTGT
GTGTGTGTGTGTGTGTGNGTNSGTGTGTASSSKGGSAAIPPVTLTESLLNKHNDEMEKFM
LKKHRESRGRTGEKSKKSANDTLKMLEYSGPGHGIKRGGSHSWEGEANKPKQQLTLGTDA
IKGAAGSAGGAVGTGGVGSGGAGVAGGGGSGTGVAGTPEGRATTTSGTGTPGGAGGGGGA
GAAAAAGASSSVGSSTPGPSSYPTCTQNINLWPPFSVGITPPVHSTHTAMAQSSFSSAGL
FPTFYYIPASLTPTSPTRSPRMHKHPHKGGTDMPTTSQQAAAAAAQAMPLQYMAGVMYPH
PSLFYTHPAAAAATAMMYQPMPFPGMANALQIPERPLGSQSAYNKSVYTTTPASMTKKVP
GAFHSVTTPAQVQRPSSQSASVKTEPGSSAAVSDPCKKEVPDSSPIPSVMGDYNSDPPCS
SSNPANNKKYTDSNGNSDDMDGSSFSSFYSSFIKTTDGSESPPDTEKDPKHRKLKSMSTS
ESKIMEHPEEDQTQHGDG
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atggagggcggcgagtccacggagtccacacacaacaccaaggtgtccgactcggcctac
tcgaacagctgcagcaacagccagtcgcagcgcagtggcagctccaaatcccgcctgagc
ggcagccactcctccggcagcagtggctatgggggcaagccctcgacgcaggccagcagc
agcgacatgatcatcaagcgcaacaaggataagtcgcgcaagaagaagaagaacaagggc
gccggccagggggcggggcaggcgcagaccctgatctcggcgtcgacgagcctagagggc
agggacgaggagaagccgcggcccagcggcactgggtgcgtagaacagcagatctgccga
gagctgcaggatcaacagcacggcgaggatcacagcgagccgcaggccatagagcagctg
cagcaggaggaggaggaggatcagtccggctccgagtcggaggcggaccgagtcgagggc
gtggccaagtcggaggcggcacagagctttccgattccctcgccgctatccgtcaccatt
gtcccgccctcgatgggcggctgcggcggagtgggccacgcagccggtctggacagcggg
ctggccaagttcgacaagacctgggaggcaggtccgggcaagctggagtccatgaccggg
gtgggcgcagcggcggcgggcacagggcagcgcggggagcgggtgaaggaggacagcttc
tgctgcgtcatctccatgcacgacggcatcgtcctgtacacgacgcccagcatcaccgat
gtcctgggctacccgcgcgacatgtggctgggcaggtccttcatcgattttgtgcacctt
aaggaccgcgccaccttcgccagtcagatcaccacgggcatacccattgcggaatccagg
ggcagcgtgcccaaggacgccaagagcaccttctgcgtgatgctgcgtcgctaccgggga
ctcaagtccggcggattcggcgtcatcggcaggcccgtcagctacgaacccttccgcctg
gggctcaccttcagggaggctccggaggaggcgcgaccggacaactacatggtctccaat
ggcaccaacatgctgctcgtcatctgcgccactccgatcaagagcagctacaaggttccc
gacgagattctctcacagaagagccccaagttcgccatacgccacacggccaccgggatc
atatcgcacgtggacagcgcggcggtcagtgcactgggctatctgccgcaggacctgatt
ggccgcagcatcatggacttctaccaccacgaggacctctcagtcatgaaggagacctac
gagacggtaatgaagaagggtcagacggcgggcgcctccttctgcagcaagccataccgc
ttcctcatccagaacggttgctacgtccttctggagaccgaatggaccagcttcgtcaat
ccatggtcccgcaagctggaatttgtcgtcggacaccatcgcgtctttcagggacccaag
cagtgcaacgtcttcgaggcggcgcccacatgtaagctgaagatatcggaggaggcacag
agccggaacacgcgaatcaaggaggatatcgtgaagcgcctggcggagacggtgtcccgt
ccgtcggacacggtcaagcaggaggtttcccgccgctgccaggcgctggccagcttcatg
gaaacgctcatggacgaggtgtcccgggcggatctcaagctggagctgccgcacgagaac
gagttgaccgtctcggagcgggacagcgtgatgctcggcgagatttcgccgcaccacgac
tactatgacagtaagagttccaccgagacgccgcccagctacaaccagctaaactataac
gagaacctgctgcgttttttcaacagcaagccggtcacggcgccggcggagctcgatccg
cccaaaacggagccgccggagccgcgcggcacgtgtgtcagtggcgccagtggtccgatg
agtcccgtccacgagggcagcgggggcagtggctcctcgggcaacttcaccaccgccagt
aacatacacatgagcagtgtgacaaatacgagcattgccggcactggtggcacgggcact
ggtacaggtacaggtactggaactggaactggaaccgggacaggaactggaaccgggaca
ggaactggaacgggaacaggtacaggcacaggcacaggcactggaacaggcaatggaaca
aattccggcaccggaaccggcaccgccagctcatccaaaggcggaagcgccgccataccg
ccagtcacgctgaccgaatccctgctcaataagcacaacgacgagatggagaagttcatg
ctgaagaagcaccgcgagtcgcgcggacggacgggtgagaagagcaagaagtccgccaat
gacacccttaagatgctggagtacagcggtccaggccacgggataaaaagaggaggctcc
cattcctgggagggagaggccaacaagcccaagcagcagctaaccctgggaacagatgcg
atcaagggagcggcaggaagtgcgggcggagcagtcggcactggcggtgtgggatcagga
ggagccggtgtggcgggcggaggaggatccggaacaggcgtagcaggcacaccagaaggc
agagccacaacgacctcgggaacggggacaccaggtggagccggaggcggaggcggagca
ggagcggcagcagcggctggagcgtcctcctccgtgggcagttccacgccaggaccctcg
tcctatcccacctgcacgcaaaacataaacctctggccaccgttctcggtgggcatcaca
ccgcccgttcactccacgcacacggccatggcccagagcagcttctcctccgccggcctc
ttcccgaccttctactacatccccgcctccttgacgcccaccagtcccacgcgctctccc
cggatgcacaagcatccgcacaagggtggcacggacatgcccaccacctcgcagcaggcg
gctgccgcggccgcccaggccatgccgctgcagtacatggccggcgtgatgtacccgcat
ccttcgcttttctacacacacccggcggcggccgcggccacggccatgatgtaccagccg
atgccctttccgggaatggccaacgctctccagattcccgaacgtccgttgggctcccaa
tccgcgtacaacaagtcggtgtacacgaccacgccggcgtccatgacgaagaaggtgccg
ggtgcattccactcggtcaccactcctgcccaggtgcagcgtccctcctcgcagagcgca
tccgtcaagacggagccgggctccagtgcagcggtatccgatccctgcaagaaggaggtg
ccggactcctcgcccattccctccgtgatgggcgactacaactccgacccgccctgcagc
agcagcaatcccgccaacaacaagaaatacacggacagcaatgggaatagcgacgacatg
gatggctccagcttctcctccttctactcgtccttcatcaagaccacggacggatcggag
agtccgccggacaccgaaaaggaccccaagcaccgaaagctgaagagcatgagcacatct
gagagcaagatcatggagcacccggaggaggaccagacacagcacggggatgggtag

DBGET integrated database retrieval system