KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2715
Entry
Dmel_CG2715       CDS       T00030                                 

Symbol
Syx4
Name
(RefSeq) syntaxin 4, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: SNARE Syntaxin ETRAMP MCPsignal DUF2116 WXG100 DUF5345
Other DBs
NCBI-GeneID: 31269
NCBI-ProteinID: NP_525057
FlyBase: FBgn0024980
UniProt: Q7KVY7 S5W2P0
Position
X:complement(2739089..2744076)
AA seq 333 aa
MGKDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSC
SNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTF
NENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHK
NELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLR
EMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQ
AEQHQKKARKKKIMLIVILAAVLLVLLLVGIYL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgggtaaagatcgactgcccgagcttttgcagcgctcattgagcacgaactcgtcgaac
tcgtcgtcgaacggttcactgcttttgaacgtgtacagtggaaccacggagttcatcatt
ggcaacaccggcggtaacaataatagctacagtgtcgttagccaaaactctcacagctgc
agcaacaataacagcagcaccgaacccaaggatcggtccagttcaaagatgacgcagtat
ggctcgaatgtggatgacatactcaatccgtacacggagattcgccaacaactcgcacag
atagccgccaacttggagacgatgaaccgcatggcccaaactgtcaatctgcgaactttc
aacgagaacgagatggatgagcttcacaacaaaaacctgaggctgggcaatcagctaatg
acgcgattcaacgacttcaaggcgaatctgccggcggaaaacgattacagcttggaggca
aggatgaaaagaacccttttctatggactccaccagactttcatcaatctgtggcacaaa
aacgaactattcctgcagaactacgagaccaaggtcaaaaagaatctgagactgcataca
aaaatcattaattctgaagccagcgaacaagaaatcgagttactcatcgagaacaagaca
accaaactctttgtggataattttctgcaggaaacggaaaaggagcggcagacactgcgc
gaaatgatggatcgattcaacgagctgcgccgcctggagaagtccatcgaggaggtgcac
gccctgttcatgcgcatccagaccctggtaatggagcagagcgaggtgatccagcgggtg
gagtttcacgcccagcaggccacgctccacgtggacaagggcgccgacgagctggaccag
gcggagcagcaccagaagaaggcgcgcaagaaaaagataatgctcatcgtgatactcgca
gccgtgttgctagtattactccttgttggtatttatttgtga

DBGET integrated database retrieval system