KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2759
Entry
Dmel_CG2759       CDS       T00030                                 

Gene name
w
Definition
(RefSeq) white
  KO
K21396  ATP-binding cassette, subfamily G (WHITE), eye pigment precursor transporter
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG2759 (w)
Transporters [BR:dme02000]
 ABC transporters, eukaryotic type
  ABCG (White) subfamily
   ABCG2, 3 subgroups
    Dmel_CG2759 (w)
SSDB
Motif
Pfam: ABC2_membrane ABC_tran ABC2_membrane_7 AAA_21 ABC2_membrane_3 SMC_N AAA_25 RsgA_GTPase AAA_16 DUF5906 AAA_28 AAA_33 AAA_22 AAA_29 BLACT_WH MMR_HSR1 cobW ABC_ATPase AAA_23
Other DBs
NCBI-GeneID: 31271
NCBI-ProteinID: NP_476787
FlyBase: FBgn0003996
UniProt: P10090
Position
X
AA seq 687 aa
MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNYGTLRPPSPPEDSGSG
SGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERHIPAPRKHLLKNVCGVA
YPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNGQPVDAKEMQARCAYVQQ
DDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQELSLSKCQHTIIGVPGRVKG
LSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQVLKKLSQKGKTVILTIHQP
SSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCPTNYNPADFYVQVLAVVPGRE
IESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQPENGYTYKATWFMQFRAVLWRS
WLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVGVMNINGAIFLFLTNMTFQNVFA
TINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPLFLTVPLVFTAIAYPMIGLRAGVL
HFFNCLALVTLVANVSTSFGYLISCASSSTSMALSVGPPVIIPFLLFGGFFLNSGSVPVY
LKWLSYLSWFRYANEGLLINQWADVEPGEISCTSSNTTCPSSGKVILETLNFSAADLPLD
YVGLAILIVSFRVLAYLALRLRARRKE
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgggccaagaggatcaggagctattaattcgcggaggcagcaaacacccatctgccgag
catctgaacaatggtgacagcggagcggcttcgcagagctgcattaaccagggcttcggg
caggccaaaaactacggcacgctccggccacccagtccgccggaggactccggttcaggg
agcggccaactagccgagaacctcacctatgcctggcacaatatggacatctttggggcg
gtcaatcagccgggctccggatggcggcagctggtcaaccggacacgcggactattctgc
aacgagcgacacataccggcgcccaggaaacatttgctcaagaacgtttgcggcgtggcc
tatccgggcgaacttttggccgtgatgggcagttccggtgccggaaagacgaccctgctg
aatgcccttgcctttcgatcgccgcagggcatccaagtatcgccatccgggatgcgactg
ctcaatggccaacctgtggacgccaaggagatgcaggccaggtgcgcctatgtccagcag
gatgacctctttatcggctccctaacggccagggaacacctgattttccaagccatggtg
cggatgccacgacatctgacctatcggcagcgagtggcccgcgtggatcaggtgatccag
gagctttcgctcagcaaatgtcagcacacgatcatcggtgtgcccggcagggtgaaaggt
ctgtccggcggagaaaggaagcgtctggcattcgcctccgaggctctaaccgatccgccg
cttctgatctgcgatgagcccacctccggactggactcctttaccgcccacagcgtcgtc
caggtgctgaagaagctgtcgcagaagggcaagaccgtcatcctgaccattcatcagccg
tcttccgagctgtttgagctctttgacaagatccttctgatggccgagggcagggtagct
ttcttgggcactcccagcgaagccgtcgacttcttttcctacgtgggtgcccagtgtcct
accaactacaatccggcggacttttacgtacaggtgttggccgttgtgcccggacgggag
atcgagtcccgtgatcggatcgccaagatatgcgacaattttgccattagcaaagtagcc
cgggatatggagcagttgttggccaccaaaaatctggagaagccactggagcagccggag
aatgggtacacctacaaggccacctggttcatgcagttccgggcggtcctgtggcgatcc
tggctgtcggtgctcaaggaaccactcctcgtaaaagtgcgacttattcagacaacgatg
gttgccatcttgattggcctcatctttttgggccaacaactcacgcaagtgggtgtgatg
aatatcaacggagccatcttcctcttcctgaccaacatgacctttcaaaacgtctttgcc
acgataaatgtgttcacctcagagctgccagtttttatgagggaggcccgaagtcgactt
tatcgctgtgacacatactttctgggcaaaacgattgccgaattgccgctttttctcaca
gtgccactggtcttcacggcgattgcctatccgatgatcggactgcgggccggagtgctg
cacttcttcaactgcctggcgctggtcactctggtggccaatgtgtcaacgtccttcgga
tatctaatatcctgcgccagctcctcgacctcgatggcgctgtctgtgggtccgccggtt
atcataccattcctgctctttggcggcttcttcttgaactcgggctcggtgccagtatac
ctcaaatggttgtcgtacctctcatggttccgttacgccaacgagggtctgctgattaac
caatgggcggacgtggagccgggcgaaattagctgcacatcgtcgaacaccacgtgcccc
agttcgggcaaggtcatcctggagacgcttaacttctccgccgccgatctgccgctggac
tacgtgggtctggccattctcatcgtgagcttccgggtgctcgcatatctggctctaaga
cttcgggcccgacgcaaggagtag

DBGET integrated database retrieval system