KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2790
Entry
Dmel_CG2790       CDS       T00030                                 

Gene name
CG2790
Definition
(RefSeq) uncharacterized protein
  KO
K09506  DnaJ homolog subfamily A member 5
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dme03009]
    Dmel_CG2790 (CG2790)
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG2790 (CG2790)
Ribosome biogenesis [BR:dme03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dmel_CG2790 (CG2790)
Chaperones and folding catalysts [BR:dme03110]
 Heat shock proteins
  HSP40 / DNAJ
   Dmel_CG2790 (CG2790)
SSDB
Motif
Pfam: DnaJ zf-C2H2_jaz zf-met zf-C2H2_2
Other DBs
NCBI-GeneID: 37992
NCBI-ProteinID: NP_611986
FlyBase: FBgn0027599
UniProt: Q9W0X8
Position
2R
AA seq 540 aa
MRCYYEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQ
ERSWYDNHREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASE
DLEFMDKDDRLGMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFI
LRKVEKEMKKIVQAARKERNEEVRNLVNFVRKRDPRVQAYRRMLEERVEANRLKQEEKRK
EQLRKRQEELAAVRKNNVFNEGYEEQLKQLEQQYDSKSEDYTDEDENDDDGEDFDHEGGQ
EAEEYEVEYVDDLYCVACNKTFKNAKARANHEESKKHNENVDRLCQEMEEEEDAFHNEPH
EDSLMGVQESLEELQVSEDQISFDGVPSEEESSLAKRTKKNKKARKSAVKQAQAEGSDEP
DEPIEKKAIKSESEDEDWSKGKKASKKSKSKKTTTRKVKLLEQTVSEPNTKEATVAPKSG
DEDLDPTKSQHTCVTCRLVFDSKNKLFAHLKKTNHGVYIPKAKPNVEGKPPGKAKGKRNK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcgttgctattacgaggagctcgagctccaaagaaacgccaacgatggggacatcaag
agtgcgtaccgtaagatggccctgcgctggcacccggacaagaatcccgaccgactggcg
gaggccaaagagcgcttccagctgatccagcaagcgtatgaagttctgtctgatcctcag
gaacggtcttggtacgacaaccatcgcgagcagatcttgcgcggcaagaactccgattat
gcggagaactgcctggacgtgttccagttcttcacgagctcctgttacaagggctatggc
gacaatgagcacggcttttaccgcgtgtacaccgatgtcttcgtccaaatcgcctcggag
gacttagagttcatggacaaggacgaccggttggggatggcgcctgactttggtcattca
aacagtagttacgaagatgtggtgggtccgttctacgccttttggcaggcatacagtacc
cggaagacctacgactggctgtgtccctacgatgttcgcgaaataaaagagcgctttatc
ctacgcaaggtggagaaggagatgaaaaagatcgttcaggctgcccgcaaggaacgcaac
gaagaggttcgcaacttagtcaactttgtgcgaaaaagggatcccagagtgcaggcctac
aggcgcatgcttgaggaacgcgtcgaggccaatcgacttaagcaggaggagaagcgcaaa
gagcagttaaggaagcgccaggaagaactggcagccgtcaggaaaaataatgtctttaac
gagggctacgaggagcagctaaagcagttagagcagcagtacgatagcaagtcagaagat
tacacggatgaagacgagaacgacgacgatggcgaggactttgaccatgaaggcggccag
gaagccgaggagtacgaagtggagtatgtagacgatctttactgcgtggcatgcaacaag
acatttaaaaacgccaaggcgcgtgctaatcacgaagaaagcaagaagcataatgaaaat
gtcgaccggctgtgtcaggaaatggaggaagaagaggacgctttccacaatgaaccccat
gaagacagtttaatgggcgtacaggaatcgctggaagaattgcaagtctctgaggatcag
atatctttcgacggggttccaagcgaagaagaatcttcgctagccaaacgaaccaaaaaa
aacaaaaaggcaaggaagtcagctgtcaagcaagcgcaggcggaaggcagtgacgaacca
gatgagccaatagaaaagaaggcaatcaagagcgagtcagaggatgaagactggagtaaa
ggcaaaaaagcgagcaaaaagagtaaaagcaaaaagacgacgactaggaaggttaagcta
ttagagcaaactgtttcggaaccgaatacaaaggaggcaacagtggctcccaaaagcgga
gatgaggacctcgacccgaccaagtcgcaacacacttgtgttacctgtaggcttgtcttt
gactccaagaacaagctgtttgcccacctaaagaagacgaaccatggtgtctacatacct
aaggcaaagcctaatgttgagggcaagcctcctggcaaagctaagggcaagcgcaacaag
tag

DBGET integrated database retrieval system