KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2819
Entry
Dmel_CG2819       CDS       T00030                                 

Gene name
Pph13
Definition
(RefSeq) PvuII-PstI homology 13
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Homeodomain Orthopox_F8
Other DBs
NCBI-GeneID: 33239
NCBI-ProteinID: NP_477330
FlyBase: FBgn0023489
UniProt: Q9XZU0
Position
2L
AA seq 357 aa
MDKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQN
RRAKWRKQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSL
DNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMD
SDNQLQQHPPQQHASDPIHAGSSSHHQQQQQQHQQEQHNPQLHPGLEFAASLSLDMTDGS
SAYDEMKFLSVDVDQFTIDSFKADCILSMEQSQMQAYGGHSQLVGSSNELCLDGIGMSSF
GMEEGEPKSPPSLLVLDKSLPSLSIGVEGIADLVEQLHHHQHEGGPVGGGVITGDVM
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggacaaaggcacaatgaagcgcaagcagcggagatacagaaccacatttaacacactg
caactgcaggagctggaaagggcgttccagcggacacactatccggacgtgtttttccga
gaggagctggccgtgaggatcgatttgacggaggcgagggtgcaggtgtggttccagaac
cggcgggccaagtggcgcaagcaggagaagatcggtgggcttggcggagattataaggag
ggtgcgttggatctcgacgtgtcctacgacgacagcgccgtcctgggccaactggatagt
gcgctgggcggcggtggaactctattgccggacaccccaccgcaatcctcgaactccctt
gataacgaacttaaggcctcctacggcacgggggccatgtcgccctctaggctgtcaccg
aatatatttctcaacctcaacattgaccacttgggactggagcggggtggcagtggcctc
tccatggagtggtccacatatcctccgcaaacgcaagcgcagacacacccgcagatggac
tccgacaatcagctccagcagcacccgcctcaacagcatgcatccgatccgattcacgcc
gggagttcgagtcatcaccagcagcagcagcagcagcaccagcaggagcagcacaatccc
cagcttcatccggggcttgagtttgccgcctcattgagtttggacatgaccgatggctcc
tccgcctacgacgagatgaagtttctcagcgtggacgtggaccagttcacgatcgacagc
ttcaaggcggactgcattctgagcatggagcagtcccagatgcaggcctacggcggtcac
tcccagctggtcggatcatccaatgaactgtgcctggacgggattggcatgtcctccttt
ggcatggaagagggtgagcccaagtcgcctccctctcttttggtgctggacaagtcgctg
ccctctttgagcataggcgtggaaggaatcgctgatctcgtggagcaactgcatcatcac
cagcatgagggcggcccagtgggcggtggtgtcatcactggcgatgtcatgtga

DBGET integrated database retrieval system