KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2845Help
Entry
Dmel_CG2845       CDS       T00030                                 

Gene name
Raf
Definition
(RefSeq) Raf oncogene, isoform E
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04150  mTOR signaling pathway
dme04214  Apoptosis - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG2845 (Raf)
   04068 FoxO signaling pathway
    Dmel_CG2845 (Raf)
   04150 mTOR signaling pathway
    Dmel_CG2845 (Raf)
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG2845 (Raf)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG2845 (Raf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG2845 (Raf)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dmel_CG2845 (Raf)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   Dmel_CG2845 (Raf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like Pkinase_fungal C1_2 zf-RING-like Kdo PHD_2
Motif
Other DBs
NCBI-GeneID: 31221
NCBI-ProteinID: NP_001096867
FlyBase: FBgn0003079
UniProt: P11346
Position
X
AA seq 739 aa AA seqDB search
MSSESSTEGDSDLYDPLAEELHNVQLVKHVTRENIDALNAKFANLQEPPAMYLIEYQELT
SKLHELEAKEQELMERLNSQDQQEDSSLVERFKEQPHYQNQTQILQQQRQLARVHHGNDL
TDSLGSQPGSQCGTLTRQPKILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDM
CEVSTTHSGRHIIPWHTDIGTLHVEEIFVRLLDKFPIRTHIKHQIIRKTFFSLVFCEGCR
RLLFTGFYCSQCNFRFHQRCANRVPMLCQPFPMDSYYQLLLAENPDNGVGFPGRGTAVRF
NMSSRSRSRRCSSSGSSSSSKPPSSSSGNHRQGRPPRISQDDRSNSAPNVCINNIRSVTS
EVQRSLIMQARPPLPHPCTDHSNSTQASPTSTLKHNRPRARSADESNKNLLLRDAKSSEE
NWNILAEEILIGPRIGSGSFGTVYRAHWHGPVAVKTLNVKTPSPAQLQAFKNEVAMLKKT
RHCNILLFMGCVSKPSLAIVTQWCEGSSLYKHVHVSETKFKLNTLIDIGRQVAQGMDYLH
AKNIIHRDLKSNNIFLHEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQ
ELNPYSFQSDVYAFGIVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQA
LKRLAEDCIKYTPKDRPLFRPLLNMLENMLRTLPKIHRSASEPNLTQSQLQNDEFLYLPS
PKTPVNFNNFQFFGSAGNI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgagtcctccaccgaaggcgacagcgatctatacgatcctttggccgaggag
ctgcacaacgtccagttggtcaaacatgtgacccgcgagaatattgatgccctgaatgcc
aagtttgccaacctgcaggagccaccagccatgtacttaatagaataccaggagttgacc
tccaagctccacgaactggaggccaaggagcaggaactaatggagcgactgaactcgcag
gaccagcaggaggactcctccttggtcgagcggttcaaggagcagccccactatcaaaat
caaactcaaatcctgcagcaacaacggcaattggcgcgagtgcaccacggcaacgatcta
accgatagcttgggctctcagccgggcagccaatgtggaactttgacccgtcagcccaag
atccttttgcgagcccacctgcccaatcaacagcgcacttcagtggaggtaatttcggga
gtacgactatgtgatgccctcatgaaggccctgaaactccggcaactaacgccggatatg
tgcgaagtaagcacaactcattccggaagacatatcataccctggcacacggatatcggc
actctgcatgtggaggagatctttgtcaggctgctggataagtttcccattaggacacac
atcaagcaccagatcatacggaagaccttcttctcgttggtattctgcgagggctgtcga
aggcttctgttcaccgggttctactgtagccagtgtaattttcgattccatcagaggtgt
gccaatagagtgccgatgctgtgccagccctttcccatggatagctactatcagctactg
ctggccgagaatccggataatggcgttggtttccccggcagaggcactgctgtccgcttc
aatatgagcagccggagtcgcagtcgtcgttgcagcagcagtggcagcagcagcagctcg
aagccaccatcttcatcctccggcaatcatcgacagggtcgtccgccgaggatcagccaa
gacgatcgatccaattccgcgccaaatgtgtgcatcaacaacattcgatcggtcacaagc
gaagtgcagcgcagtttgataatgcaggccagacctcctttgccgcatccgtgcacagat
cactccaactccacgcaagcgtcgcccacgagcaccttgaaacacaatcgtcccagggcc
aggtccgccgatgagagcaataaaaatctgcttttaagagacgccaaaagttccgaggaa
aactggaatattctggcggaggagattttaattgggccgcgcatcggatcgggttccttt
ggaaccgtttatcgcgcccattggcacggtcccgtggccgtaaagacactcaacgtgaag
acaccgagtcccgcccagttgcaggcgtttaagaacgaggtggccatgctgaaaaagacg
cgccactgcaatatcctcctcttcatgggctgtgtatccaaaccatctctagcgattgtg
acccagtggtgcgagggcagcagtctctacaagcacgtccatgtcagcgaaaccaagttt
aaattgaacacgctcatcgatatcggacgtcaggtggcccagggcatggattacctgcat
gccaagaatatcattcatagagacctcaagtcaaacaacatctttttgcacgaggatctt
tccgtgaagataggcgacttcggattggccactgcgaaaactcgatggtcgggtgaaaag
caagccaatcaacccacgggcagtattttatggatggctccagaggtgattcgcatgcag
gagctaaacccctactccttccagtcggacgtttatgcctttggtatcgtgatgtacgaa
ctgttggcggagtgcttgccctacggtcatattagcaacaaggatcagatcctgtttatg
gtggggcgaggacttctgcgtccggacatgagtcaagtgcgctcggatgcgccgcaggca
ttgaagcgcttggccgaggattgcattaagtatacccccaaggatcgaccgctctttagg
ccgctgctcaatatgctggagaacatgctgcgcactttgcccaaaattcatcgcagtgcc
agtgaaccaaacttgacgcaatcgcagctgcagaacgatgagtttctgtatctgcccagc
ccgaaaacgccggtgaacttcaacaactttcagttcttcggcagcgctgggaatatctag

DBGET integrated database retrieval system