KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2846Help
Entry
Dmel_CG2846       CDS       T00030                                 

Definition
(RefSeq) CG2846, isoform B
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00740  Riboflavin metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dmel_CG2846
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Dmel_CG2846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavokinase
Motif
Other DBs
NCBI-GeneID: 40936
NCBI-ProteinID: NP_001287218
FlyBase: FBgn0014930
UniProt: O76206 A0A0B4LHX1
Position
3R
AA seq 153 aa AA seqDB search
MLSQLPLFAGGEIVRGFGRGSKELGIPTANFPLEVVKSLPESLPTGAYYGWANVDNGPVH
KMVLSIGWNPFYNNKEKSVETHMLHDFNCDLYGQTLKICIVGYLRPERSFDSLESLIAAI
RGDIEQAKAFLDEADKAKLKEAPFFTEKLCSSK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccaactgcctctgttcgctgggggcgagattgttcggggcttcggacgcggc
tccaaagagctgggcatcccaacagctaactttccgctggaggtggtgaaatcgctgccg
gaatccctgcccactggcgcgtactacggttgggcaaacgtggataatggacccgtgcac
aagatggtcctcagcatcggctggaatcccttctacaacaacaaggagaagagcgtggag
acgcacatgctacacgactttaactgtgacctttacggccagacactcaagatatgcatt
gtaggctacctgcgaccggagcgcagtttcgactccctggagtcactgattgccgccatc
cgcggggacatcgagcaggccaaggcgttcctcgacgaggcggacaaggccaagctgaag
gaggctccgttctttacggagaagctctgctcgtcgaaatag

DBGET integrated database retrieval system