KEGG   Drosophila melanogaster (fruit fly): Dmel_CG2960
Entry
Dmel_CG2960       CDS       T00030                                 

Gene name
RpL40
Definition
(RefSeq) ribosomal protein L40, isoform B
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
dme04120  Ubiquitin mediated proteolysis
dme04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG2960 (RpL40)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG2960 (RpL40)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG2960 (RpL40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG2960 (RpL40)
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG2960 (RpL40)
Ribosome [BR:dme03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Dmel_CG2960 (RpL40)
  Archaea
    Dmel_CG2960 (RpL40)
Ubiquitin system [BR:dme04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   Dmel_CG2960 (RpL40)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 33629
NCBI-ProteinID: NP_001260018
FlyBase: FBgn0003941
UniProt: P18101 Q7JYK1
Position
2L
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRILAQKYNCDKMICRKCYARLHPRATNCRKKKCGHTNN
LRPKKKLK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaaccctcaccggcaagaccatcaccttggaggtggagccttct
gacaccatcgagaatgtcaaggctaagatccaggataaggagggcattcccccagatcag
cagcgtctgatcttcgccggcaagcagctggaggatggccgcactctgtccgactacaac
attcagaaggagtccaccctgcacttggtgctccgcctgcgtggtggtatcattgagccc
tcgctcaggattctggcccagaagtacaactgcgacaagatgatctgccgcaagtgctac
gcccgtctgcatcctcgtgccaccaactgccgcaagaagaagtgcggacacaccaacaac
ctgcgccccaagaagaagttgaagtag

DBGET integrated database retrieval system