KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3006
Entry
Dmel_CG3006       CDS       T00030                                 

Symbol
Fmo-1
Name
(RefSeq) Flavin-containing monooxygenase 1
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    Dmel_CG3006 (Fmo-1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     Dmel_CG3006 (Fmo-1)
SSDB
Motif
Pfam: FMO-like Pyr_redox_2 Pyr_redox_3 NAD_binding_8 HI0933_like Pyr_redox DAO Thi4 Lys_Orn_oxgnase FAD_binding_2 FAD_binding_3 GIDA Amino_oxidase NAD_binding_9 FAD_oxidored Lycopene_cycl AlaDh_PNT_C RhoGEF
Other DBs
NCBI-GeneID: 37814
NCBI-ProteinID: NP_611859
FlyBase: FBgn0034943
UniProt: Q9W1E9
Position
2R:23962956..23964641
AA seq 416 aa
MMSVCIIGAGTAGLCCARHSIANGFETTVFELSDRIGGTWVYNEATGAVNGIDVHSSMYK
NLRTNLPKEVMGFPDFEIGANEASYVRSDEICDFLNQYANHFDLKKHIKFDSYVIRVLQR
KTKWQVLFKDLVTNKIEFQYFDKVLVANGHYHTPNYSQIPNMERFKGQFLHSHDFRSREV
FEGKSVLVIGAGPSGMDLSNIISRTADRVTISHHLTDIGQHSFFENVQQKPDVRELDEKG
AFFVDGSYQEFDTVFFCTGYKYAFPFLTVDSGIYVEDNYVQELYKQCINIRNPSMALIGL
PFYVCAAQMMDIQARFIMSYYNGSNELPSTEDMLKDTRDRMGKLWAEGLRKRHAHMLGPK
QIDYFTDLSQTAGVKNIKPVMTKLHNESSKCFNENLLHFREDNFAILDDETFIKLN
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgatgagcgtttgcataattggggccggaaccgcgggtctttgctgtgcccgccattcg
attgcaaatgggttcgagaccactgtgttcgagctatctgaccgaatcggcggcacctgg
gtttacaatgaggcaacaggggcggtcaatggcatcgatgtccacagcagcatgtacaag
aacctacgaaccaacctgcccaaggaggtaatgggcttcccggacttcgaaatcggggca
aacgaggcttcctatgtgagatccgacgagatctgcgacttccttaaccaatacgcgaac
catttcgacctgaagaagcacatcaagttcgatagctatgtgattcgagttttgcagagg
aaaacaaagtggcaagtacttttcaaagacttggtcaccaacaagatagagttccagtac
ttcgacaaggtcttggtggccaatggccactaccacactccgaattatagccaaattccg
aatatggaaaggtttaaagggcagttcctgcacagccacgacttcagaagtagggaggtt
ttcgaaggtaaatccgttctggtcattggagctggtcccagtggcatggacctgtcgaac
atcatttcccgaacggcggatcgggtcaccataagtcaccacttgaccgatatcgggcaa
cactcattcttcgagaacgtacagcagaaacccgatgtgcgggagctcgatgagaaggga
gcctttttcgtggacggatcgtaccaggagttcgacaccgtcttcttttgcacaggttac
aagtacgcctttcccttcctgaccgtcgactcgggcatctatgtggaggacaactacgtc
caggagctgtacaagcagtgcatcaacatcaggaacccatccatggctctgatcggactg
ccgttttacgtttgtgccgcccaaatgatggacatccaagcgaggttcatcatgagctac
tacaacggatccaacgagttgccgtccacggaggatatgctcaaggacacccgcgatagg
atgggcaaactgtgggcggagggactaagaaaacgccatgcccacatgctgggtcccaag
caaatcgactatttcacggacttgtcgcaaactgcaggagttaagaacatcaagcctgtg
atgaccaaattgcacaacgaaagcagcaagtgcttcaatgagaatttgctccacttccgg
gaggacaatttcgcgattctggacgacgagacattcattaaactcaactag

DBGET integrated database retrieval system