KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30106Help
Entry
Dmel_CG30106      CDS       T00030                                 

Gene name
CCHa1-R
Definition
(RefSeq) CCHamide-1 receptor
  KO
K04170  bombesin receptor subtype-3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dmel_CG30106 (CCHa1-R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG30106 (CCHa1-R)
G protein-coupled receptors [BR:dme04030]
 Rhodopsin family
  Peptide
   Bombesin
    Dmel_CG30106 (CCHa1-R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 37004
NCBI-ProteinID: NP_611241
FlyBase: FBgn0050106
UniProt: A1ZAX0
Position
2R
AA seq 499 aa AA seqDB search
MIANLVSMETDLAMNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSE
NFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYI
LSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRY
FAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVIC
YPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVR
ARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSC
ANPVALYFVSGAFRKHFNRYLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHS
CYQSTIRSCRLQETTITTLPNGGNQNGANISAVELALPVLQAPGHNEAHAPPSYGFLPLN
EIVQQTRSSPAKFQESLLN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatagccaacttggtgagcatggaaacggacttggccatgaacatcggcctggacact
tccggtgaagcccccacagccctacccccgatgccgaatgtcaccgagacgctgtgggat
ctggccatggtggtcagtcagtccacacagtggcccctcctggacaccggctcgtccgag
aacttcagcgaactggtcaccaccgagacaccctacgtgccctacggccgtcgaccggaa
acctacatcgtgcccatcctctttgccctgatcttcgtggtcggtgtcctgggcaatggc
actttgattgtggtcttcctcagtgtgcgacagatgcgaaatgttccaaacacctacatt
ttatcactggccctggccgatctgctggttattataaccacagtgccgctcgcatccaca
gtttacacagttgaatattggccatatggcagcttcctgtgcagcctgtcggagttcatg
aaggatgtgtccatcggagtgtcagtgtttacgctgactgcattatccggcgatcggtac
tttgccatcgtggatcctttgaggaagttccacgctcatggtggtggtcgtcgggccacc
agaatgaccttggccaccgcggtttccatttggctgctggccatactctgcggacttcca
gcgctaattggaagtaacctgaagcatctcggcataaacgaaaagtccatagtcatttgc
tatccgtatccggaggagtggggcatcaactacgccaagtccatggtcctgttgcacttc
ctggtctactacgccattcctttggtcgtcatagcagttttctacgtgctcatcgccctc
catttgatgtattcggccagtgttcctggtgaaattcagggagctgtgcgtcaggttcgt
gcccgtcgcaaagtggctgttactgtgctggccttcgttgtcatctttggaatttgcttt
ctgccctaccacgtcttcttcctctggttctacttctggcccaccgcccaggatgattac
aatgccttctggcatgtgctgcgcatcgtcgcctactgcatgtcctttgccaacagctgt
gcgaatcctgtggccctatacttcgtgagcggcgcctttcgcaagcatttcaatagatat
ctgttttgccgcggagcaagtggacggcgcaagaagcgcggccagcacgataccttctgc
atgcaccgggacacctcgctgaccagcacggcctccaagcgtttccagtcccgtcactcc
tgctaccagagcaccatccgcagctgtcgcctgcaggaaacaacgataaccaccctgcca
aatggtgggaatcagaatggagccaacatttcagccgtggaattggcattgcccgtgctc
caagcaccaggtcacaatgaagcacacgcaccgccgtcctacggatttttgccgcttaac
gagattgtccagcagaccaggtcgagtccggccaagttccaggaatcgctgttgaactga

DBGET integrated database retrieval system