KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30122
Entry
Dmel_CG30122      CDS       T00030                                 

Gene name
CG30122
Definition
(RefSeq) uncharacterized protein, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: AAA_33 SPRY SAP Zeta_toxin AAA_18
Other DBs
NCBI-GeneID: 37146
NCBI-ProteinID: NP_001163196
FlyBase: FBgn0050122
UniProt: E1JGL8
Position
2R
AA seq 1272 aa
MDVAKLEKMKVVDLRNELQSRGLDTKGVKAVLVERLRAYVEGGAGDGENAPVTPSRRQRR
TRSMSRSPSPVQAAPVAAEPVLDTLEEEEQPEDKTVPQPEPESEQPAAEPEPEQSEPEEA
EPAAAVTEDTTVNQAVNEESQPEPEEFDEKSETDDKQETIEEAVPAVVPQNEVADEPMEE
DHDAAPEEQEPTQTEEPVEEKPAESTVAEHQSNGDSQKMDVDEEDSAAPKTAEETEPAAK
PEDQPPERRKRSHSRSKSRSRSGSRSSKHRGSVGDKRESKAAAEERTVPEDEPTIEENKV
GLSWLDSDLHLRIDPTTFASAKPLTSEIYSLIWSGARANYGVREGKVCFEVRLSEESVPE
NSHYFRDEPHVRGFRVGFSMPKSSLLLGEAEHSFGYCETGRKATQSEFTDYGKPYQLDDV
IGCYLDLESEPCTINYTLNGEDLGVAFEFEKSILGEEGALFPHIVTKGYEYLVNFSDTEQ
LLVNAERPTRKRRKPRKDEDKDKDDDKDDNDGEKWKVLDEATADDDEVEKKDEDGKASSE
KDEEEAEDPEKAKEDEAAPKTETEAETKVEAPAEAAKPESEATEASETAETSTEKSSETA
AVSNGDAAAEQANDEKASEDKKPSENNDEEDEDGPSPNKRPKTDGDSEKAESEKEKDRSQ
TTEDEYEDVVPEPRDTAALLEGYVLIGLVPVEKLVSGPQRVGSRKECEVILLVGLPGAGK
THWAHKHVAENADKRYELIGPDAFISKMTIDGASRKTVHKGRWDKVYEICLNSLAALEDI
AMKRRRNFILDQTNVYASAQRRKMKGFNDFKRIAVVCIPSEDELKRRIAEKEEKGNAFTV
KESTINNLRANFTLPSLEFGWFDDINYTELTGDEAKSEVKKYNEKGKKAIDAERSRDKRS
RGSRDNYRRDDRNRNRYNDDRRRDYGGQRHESRWSDSRRGGGGGGYSSNSGGGGSRGYDN
RRNYNSGSGGQQNWVQNSRRSGYDDRGYGGGGSGSRGYDNRNRGYAGGSGGGGGGGGGGG
GGGGQQNWMQNNRRSGYDDRGYGSSRDYRDRDRGNDRSRMGSNDRNRGSSQSSYRSGGGT
HQQRDFRPGHRDTKEDSRGGYERSAGQSLPKYGNNTAVGGGYDQYKQQGGAPGGGKASLS
GKWSTYSQHHQQQQAPQHQQTGIWQTQQQSQQYQQPQQAAAGQQQYWAYNQMQTGYGNQQ
AWQSADPQQQQQWMSWWQQQQQGSGGAAAGNASGGSGVNVGGGAGNNDGGAANHYWSQYS
YSTQSNAGADKK
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggatgtggcgaagctggagaagatgaaggtggtggacctgcgcaacgagctccagtcg
cgcggcctggacaccaaaggagtcaaagcggtgctcgtcgagcgcctgagggcatatgtg
gaaggaggagccggcgacggtgaaaatgcgccggtcacaccaagccgccgtcagcgtcgc
acgcgctctatgtcccgctctccatcgccggtgcaagctgctcccgtggccgcagaacca
gtgctcgatactctcgaagaggaggagcagccggaggataagacagtgccacagccagaa
ccagaaagtgaacagccagcagccgagccggaaccagaacaaagtgagccggaggaagct
gagccagctgcagcagtgacagaggacacaaccgtcaaccaagcggtcaatgaggagtcg
cagcctgagcccgaagagtttgatgaaaagtcggagacagacgacaagcaggagacaatc
gaagaggcagtacccgccgtcgtaccacagaatgaagtggctgatgaacccatggaagag
gatcatgatgctgcccctgaggagcaggaacctacacaaactgaggagcctgtagaggag
aaaccagccgagagcactgtggccgagcatcagtcaaatggcgacagccagaaaatggac
gttgatgaggaggattcggccgccccgaaaacggcggaggagaccgagccagcagctaag
cctgaggatcagcccccggaacgccgcaagcgatcacacagtcggtccaaatcccgatcg
cgcagtggctcccgctcgtccaaacatcgcggcagcgtaggtgacaagcgtgagtcaaag
gcagcggccgaggaacgcacagttcctgaggacgagccaaccatcgaggagaacaaagtc
ggattgagctggctggactctgacttgcatttacgcatcgacccaaccacgtttgcatcg
gccaaacccctgacatcggaaatttactcgcttatttggtccggagcccgcgcaaactac
ggagtgcgcgaaggcaaagtgtgctttgaggtgcgcctttccgaggagtcggtgccggag
aactcgcactacttccgcgatgagccgcatgtgcgaggattccgcgtgggattttcaatg
cccaagagctccttgttgctaggcgaggccgagcattcatttggctattgcgagaccggg
cgtaaggctactcagagcgagtttaccgattacggcaagccttaccagctggatgacgtt
atcggctgctatttagatctggaaagtgagccgtgcacaattaactacactctgaacggc
gaggatcttggagttgcgttcgagtttgagaagagcatactgggcgaggagggagccctg
tttccgcacatcgttaccaagggctacgaatacttagtgaatttctctgacaccgagcag
ctgttggtgaatgccgagaggcccacgcgcaagcgccgcaagccacgtaaagacgaagac
aaggataaggacgacgataaggatgacaacgatggcgagaagtggaaggtcttggacgaa
gccacggcggatgatgatgaggtggagaaaaaggatgaagatggcaaggcttcttcggag
aaagatgaagaggaagccgaagatcctgaaaaagccaaagaggatgaggcggcgccaaaa
acggaaacagaagccgaaactaaagtcgaggctcctgctgaagctgctaagcccgaatca
gaagctaccgaggcttcggaaactgctgaaacttctaccgaaaagtcgtcagaaactgca
gctgtgtcaaatggtgatgctgctgcagaacaggcaaacgatgaaaaggcatctgaggat
aagaaaccctccgaaaacaatgatgaagaagatgaggatggcccctcgccgaacaagcga
cccaaaaccgatggagattcggaaaaggctgaatccgaaaaggaaaaggacaggtcgcag
acgaccgaagatgagtacgaggatgtcgtgcccgagccaagggatacagctgccctgctg
gaaggctatgtattgatcggcttagtacctgtcgaaaagctggtttccggtccacaacgc
gtcggatctcgcaaggagtgcgaagtcattttactggttggcttgccaggagccggaaag
acccattgggcccataagcatgtggccgagaatgctgacaagcgttacgagttgattgga
cccgacgcattcatttcaaagatgacaatcgatggcgcctctcgcaagactgtgcacaaa
ggtcgatgggacaaggtgtacgagatatgcttaaatagcttggcggctctggaagatatt
gccatgaagcggcgtcgaaatttcatacttgatcagaccaatgtgtatgcctcggcccag
cgacgtaaaatgaagggttttaacgacttcaagcgaattgcggtcgtttgcatacccagc
gaagatgaattgaaacgtcgcatcgccgaaaaagaggaaaagggaaatgcttttacagtt
aaagaatcaacaattaataatttacgagccaacttcacacttccctcgctggagtttggc
tggttcgatgatataaactacacggagctgactggtgacgaggccaagagcgaggtcaag
aagtacaacgagaagggcaaaaaggccattgacgcggagaggtcgcgtgacaagagatcc
cgaggaagtcgcgacaactatcgtcgtgatgaccggaaccggaatcgatacaatgatgac
cgacgtcgtgattatggcggccagcggcacgaaagtcgttggagcgactcccgcagggga
ggcggcggtggcggttactccagcaatagtggtggaggcggcagtcgtggctacgacaat
cgccgcaactacaacagcggtagcggtggccagcaaaattgggtgcagaacagccgcaga
agcgggtacgatgatcgcggctatggtggcggtggaagcggcagtcgtggatacgacaat
cgcaaccgtggatacgcaggcggcagcggtggtggtggcggcggcggcggtggtggtggt
ggtggtggtggtcagcaaaactggatgcagaacaaccgcagaagtgggtatgacgaccgc
ggctacggcagctcgcgggactatcgcgatcgagaccgtggcaacgaccgcagtcgaatg
ggcagtaacgaccggaaccggggcagcagccagagtagctatcgctcgggaggtggtact
catcaacaacgggattttcggcctggccaccgcgacaccaaagaagatagtcgcggtggc
tatgagcggtcagctggtcaatcgctacccaagtatggcaataacaccgctgtaggcggt
ggctacgatcagtacaagcaacaaggtggagcacctggcggaggcaaggcctcccttagc
ggcaagtggagtacgtacagtcaacaccatcagcaacagcaggcgccgcagcatcaacaa
acgggcatctggcagactcagcagcagtcacaacaataccaacaacctcagcaagcagcg
gcgggccagcaacaatactgggcctataaccaaatgcagacaggttatggcaaccaacag
gcctggcagagtgccgatccgcagcagcaacaacagtggatgtcctggtggcagcagcag
cagcagggctctggcggagcagcggctgggaatgccagtggcggatcaggcgtaaatgtc
ggcggcggcgctggcaataatgatggcggtgccgccaatcattactggtctcaatattcg
tactccacgcagtccaatgcgggtgccgacaagaagtag

DBGET integrated database retrieval system