KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3018Help
Entry
Dmel_CG3018       CDS       T00030                                 

Gene name
lwr
Definition
(RefSeq) lesswright, isoform C
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
dme04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dmel_CG3018 (lwr)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dmel_CG3018 (lwr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG3018 (lwr)
Ubiquitin system [BR:dme04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   Dmel_CG3018 (lwr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B
Motif
Other DBs
NCBI-GeneID: 33226
NCBI-ProteinID: NP_001259833
FlyBase: FBgn0010602
UniProt: Q7KNM2
Position
2L
AA seq 159 aa AA seqDB search
MSGIAITRLGEERKAWRKDHPFGFVARPAKNPDGTLNLMIWECAIPGKKSTPWEGGLYKL
RMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL
NEPNIKDPAQAEAYTIYCQNRLEYEKRVRAQARAMAATE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcattgctattacacgattgggggaggagcgcaaggcctggcgcaaggatcac
ccattcgggttcgtcgcacgacccgccaagaaccctgacggcaccctcaacctgatgatc
tgggagtgcgccattcccggcaagaagtccaccccctgggagggcgggctctacaagctg
cgcatgatcttcaaggacgactaccccacctcgccgcccaagtgcaagttcgaaccgccg
ctgttccacccgaacgtctatccctcgggcactgtttgcctgtcgctgctggacgaggag
aaggactggcgccccgccatcaccatcaagcaaatcctgctgggcatccaggacctgctc
aacgagccgaacatcaaggacccagcccaggcggaggcctacaccatctactgccagaac
cgactggagtacgagaagcgcgtgcgtgcccaggcccgcgccatggcggccactgagtag

DBGET integrated database retrieval system