KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30329
Entry
Dmel_CG30329      CDS       T00030                                 

Gene name
Vha100-3
Definition
(RefSeq) vacuolar H[+] ATPase 100kD subunit 3
  KO
K02154  V-type H+-transporting ATPase subunit a
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
dme04142  Lysosome
dme04145  Phagosome
Module
dme_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG30329 (Vha100-3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG30329 (Vha100-3)
   04142 Lysosome
    Dmel_CG30329 (Vha100-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG30329 (Vha100-3)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG30329 (Vha100-3)
SSDB
Motif
Pfam: V_ATPase_I SDP_N
Other DBs
NCBI-GeneID: 246543
NCBI-ProteinID: NP_725837
FlyBase: FBgn0028669
UniProt: A1ZBF7
Position
2R
AA seq 904 aa
MRVFKKRQTKVKSFFRSEDMDLCQLLLHTENAFDCLIEVGHHGAVQFNNVYDEDRLLNNL
YSKKVTQCYELLRIVDSLHTYIVQLHVNEIFYPDVDRENRLKEKDLAKYSDSLKRIHVEA
SAVTEHYYRLDSRRNRMMEHSFALNKANKYMVSDMGSELLYSESTVIGLVQDATTTSGAY
PAHLNYMIGCIRADKFYSFELLLYRLCSFNLIIRFSEMPSPVYEYHYGYKPERVRKFAIL
MMASSTMIWPKVLKICAHYHVNIYDCPSSASQREDKVKELSQEIVNVEKVLKEAELMRRQ
ILEVAGRDLFIIRVNLRKALKVYDLMNRLRLVGGVEVPRYLLAEVYIPSSDVPEVEVILR
NASRISGGADNIDSSDEDEMNDMKTMPNTTPYPIEADFQPLEDMSAGAILLKKNRLVNHM
PPTYFRLNKFTRGFQNLIDAYGMADYKELNPAPYTIITFPFLFAVMFGDLGHGILLILFS
SLMIWKHREIEKYQINATSENEILNILYAGRYIILLMGVFSVYMGLVYNIVMAKGFNLFG
SSWSCRYNETTVYDPAFHVTLDSSHPHFYSGHPYPLGMDPVWAVCGQDSITTTNSLKMKM
AIVLGISQMMFGLGLAAANCVLMNRKADLILVVIPQMIFMLCLFGYLVFLIFYKWMSYGG
HKPAPYNAACAPSVLITFINMMLMKKEDPVENCLDYMYPNERMIEFALVGIAFCTIPILL
AGKPIYLMRRRRKMQQERERDFKRMRRQTIAEMRSTMRYTDDDNSETSRQKSVDNEEEHE
MSEIWIHSGIHTIETVLGSVSHTASYLRLWALSLAHDQLSDVLWHMVLTKGFANTLPLYY
GVPVLMATFFAWAILTVAILVMMEGLSAFLHTLRLHWVEFQSKFFGGAGESFKAFNFPTS
NQRS
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgagagtatttaagaaacggcagacgaaagtcaagtcctttttccgcagcgaggacatg
gatttgtgccaactgctgctgcacacggaaaacgccttcgattgcctcatagaggtggga
caccatggagcagtgcagttcaacaatgtctacgatgaggaccgattgctgaacaacctc
tactccaaaaaggtgacgcagtgctatgagctactgcgcatcgtggacagtctgcacact
tacatcgtccaattgcatgtgaacgaaatattctatccggatgtcgatcgagagaatcgg
cttaaggagaaggatctggccaagtatagtgatagtttgaaacgcatccatgtggaggcc
agtgccgtgacggagcactactaccgactggacagtcgtcgaaatcggatgatggagcac
agcttcgctttgaacaaggccaacaagtatatggtttccgacatgggcagtgaactgctc
tattcggagagcacagtgattggtttggttcaggatgccacgaccacctctggagcttat
ccggctcatctgaactatatgatcggctgcatccgagctgataaattctatagctttgag
ctgctgctctaccgcttgtgctccttcaacctgatcattcgattttccgaaatgcctagt
ccggtctacgaatatcattatgggtataagccggaaagggtgcgcaagtttgcaattctc
atgatggccagttcaacgatgatctggcccaaggtgcttaagatatgtgctcactatcat
gttaacatctacgactgccctagttctgccagccagcgggaggataaggttaaggagctg
agccaggagatagtgaacgtggagaaggtcctcaaggaggccgagctgatgcgccgccag
atcctggaggttgctggtcgggatctattcattatacgtgtgaatctgcgcaaagcgctg
aaggtgtacgatctgatgaatcgcctgagattggtgggtggagtagaggtacctcgttat
ctgctggccgaggtgtatataccatcgtcggatgttcccgaagtggaggtaatcctacga
aatgcgtcccgaataagtggtggtgcggataatattgattcatccgatgaagacgagatg
aatgatatgaaaacaatgcccaatactactccctatcccattgaagccgacttccagccg
ctcgaggatatgagtgctggagccatattgctaaagaaaaacagactggtcaatcatatg
ccaccgacgtactttcggctaaacaagttcaccaggggattccagaacctaatagacgcc
tatggtatggccgattacaaggagttgaatcccgctccgtacaccatcatcacattcccc
ttcctgtttgccgttatgtttggcgatctgggtcatggaattctgctaattttgttctcc
tcgctcatgatttggaagcacagggagatcgaaaagtatcagattaacgcgacctcggag
aacgagatcctgaatatcctatatgcgggacgctacataatcttactgatgggtgtattt
tccgtctacatgggcctagtctacaacatagtcatggccaagggcttcaatctttttggt
tcgagctggagttgtcgatacaatgagaccactgtgtatgatcccgcttttcatgtgacc
ctggactcttcgcatcctcacttctactcgggccatccgtatccattgggaatggatcca
gtgtgggccgtgtgcggacaggactcgataaccacgaccaattcgttgaagatgaagatg
gccattgtcctgggcatatcacaaatgatgtttggactgggcctggctgccgctaattgt
gtgctgatgaatcggaaagcagatctcattctggtggtcattccgcagatgatcttcatg
ctgtgcctcttcggctacctcgtctttctgatcttttacaagtggatgtcgtacggaggc
cataagccggcgccctacaatgctgcgtgtgctccctccgttctgatcaccttcattaac
atgatgctgatgaaaaaggaagacccggtggaaaactgcctggattatatgtatcctaat
gagcggatgatagagttcgccctggtaggaatagccttttgtacgatacccattttattg
gccggcaagccgatatatctcatgcgtcgtcgcagaaaaatgcaacaggaacgggaacgg
gattttaagaggatgcgacgtcagacgatcgcggaaatgcgatccacaatgcggtacacg
gatgatgataacagtgagaccagcaggcagaaaagcgttgacaacgaggaggagcacgag
atgtcggagatttggattcactctggaattcacactatcgaaacggtattgggctcagta
tcgcatacagcctcctatcttcgattgtgggccctctcgttggcacacgatcagctgtcc
gatgtcctgtggcacatggttctgaccaagggattcgccaacactctgccattgtactat
ggtgtgcccgtgctcatggccactttcttcgcctgggccattctcacagtggccatactg
gtgatgatggagggattgagcgccttcctgcacaccctgcggctccactgggtggagttc
cagtcgaagttcttcggcggagcgggcgagtcgttcaaggcattcaatttcccgacgtca
aaccagaggagttag

DBGET integrated database retrieval system