KEGG   Drosophila melanogaster (fruit fly): Dmel_CG30340
Entry
Dmel_CG30340      CDS       T00030                                 

Gene name
CG30340
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 246550
NCBI-ProteinID: NP_724812
FlyBase: FBgn0050340
UniProt: A1Z7X3
Position
2R
AA seq 396 aa
MASVSSSDDFDFGKWDFPAERIWLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNR
SLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVL
NLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFYRSYRVRVWKNFTE
RYCKENTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKLDRYEKRVLSRENPLTVSYKR
SVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNP
LIYGFNNENFRRAYYQISWVRRWRDATQMKKFSRSPDHCCYCAFMKNGKRTSEAAQKAGN
LEKDISKDMSSAQQSAKSTKIVENEFVSEIEADGFI
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcttcggtttccagcagcgacgattttgacttcggcaaatgggacttcccagccgag
cgcatctggctgcacaagcccaatggggagatcacctggaagatctgcacttttctacca
ctgattgcttttggtctgtatggaaacttcagcatggtttatgtgatagccaccaaccgt
tctttgcgctcgcccaccaacttgattattgcaaatatggccgttgcggatctactgacc
ctggccatttgtcctgccatgttcatggtgaacgacttctatcagaactaccagttggga
tgcgtgggctgcaagctggagggctttttggtggtggtcttcctcatcacagccgtgctc
aatctctcggtagtcagctacgatcgtctcacggccatcgtgctgccaatggagacgcgc
ctcaccataaggggcgtccagatagtggtggtctgcacctgggtctcgggtatcctattg
gcatcaccattggctttctatcgctcttacagggtgcgagtgtggaagaactttacggag
cgatattgcaaggagaacacctctgtgctgcccaagtactggtatgttctgatcaccatt
ctggtgtggctgccattaggcatcatgcttatctgctacatagccatattttataagctt
gatcggtatgaaaagcgggtcctaagtcgcgagaacccgctgacagtgagctataaacgc
agcgtggccaagacactgttcattgtggtcgttgtctttgcagctctacgactgcccttt
acaatcctggttgtactacgggaaaaatacttcggtgaagatgtctctgtcagcagtgga
atgcagctattctggtacatatcacagtatttgatgtttctgaacgccgccgtcaatccg
ctgatctatggcttcaacaatgagaactttagaagggcctactaccaaatttcttgggtt
cgccgatggcgagacgccacccaaatgaagaagttttctcgatcaccagaccactgctgc
tactgtgcctttatgaagaatggaaaacgaacctcagaggcagcacaaaaggcaggaaat
ttagaaaaagacataagcaaggatatgtcgtcggcacaacaatcggccaagtcaacgaag
atagttgaaaatgaatttgtatcagaaatcgaggcagacggatttatataa

DBGET integrated database retrieval system