KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3083
Entry
Dmel_CG3083       CDS       T00030                                 

Gene name
Prx6005
Definition
(RefSeq) peroxiredoxin 6005
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG3083 (Prx6005)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     Dmel_CG3083 (Prx6005)
    1.11.1.27  glutathione-dependent peroxiredoxin
     Dmel_CG3083 (Prx6005)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     Dmel_CG3083 (Prx6005)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C AhpC-TSA_2
Other DBs
NCBI-GeneID: 33493
NCBI-ProteinID: NP_523463
FlyBase: FBgn0031479
UniProt: Q9VQI7
Position
2L
AA seq 222 aa
MSGKALNIGDQFPNFTAETSEGRIDFYDWMQDSWAILFSHPADFTPVCTTELSRVAALIP
EFQKRGVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEI
NAEGIPLTCRAVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWK
QGGKCMVLPTVKAEDVPKLFPDGIETIELPSGKSYLRITPQP
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtccggaaaggctttaaacattggcgatcagttcccaaacttcacggctgagaccagc
gagggtcgaatcgatttctacgactggatgcaggacagctgggccattctgttctcccat
ccggcggattttacgccggtttgcaccacggaattgtcccgggtggcggcattgattccg
gaattccaaaagcgtggagtcaagccaattgcactgtcctgcgacaccgtggagtcgcac
aagggttggatcgaggacatcaagagctttggcaagctgagctcctttgactatcccatc
attgcggacgacaaaagggaactggcgctcaagtttaatatgctggacaaggacgagatc
aatgccgagggcattcccctcacctgtcgcgccgttttcgtggtggacgacaagaagaag
cttcgcctgtccatcctgtatcctgccaccactgggcgcaactttgatgaaatccttcga
gtgatcgactcgctccagttgacccaaacaaagagtgtcgcgacgccggcggattggaaa
cagggcggcaagtgcatggtcttgcccaccgtcaaagccgaagatgttcctaagctcttt
cctgatggtatcgaaaccattgagctgccctccggaaagagttacctgcggatcactcca
cagccctaa

DBGET integrated database retrieval system