KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31004
Entry
Dmel_CG31004      CDS       T00030                                 

Gene name
mesh
Definition
(RefSeq) mesh, isoform D
  KO
K23820   
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: AMOP NIDO VWD Sushi TIG Haspin_kinase
Other DBs
NCBI-GeneID: 43688
NCBI-ProteinID: NP_001163782
FlyBase: FBgn0051004
UniProt: Q0KHY3
Position
3R
AA seq 1454 aa
MRFKLFVVCALACGFMAFVLANENISTEEFEDQIINAVPEPVKVTKPKAQAEFVEVPKAT
PAPKKAEADNPKTKPLALQKPTLIPVVHVSSRGTDDILTVAGLKPEKMFGALIMPNDYLG
ELYDVDNSGYNWDPNNNVAPPTTYSTAAGGYTITAARLAELRSNFMYWYFDKDMYGGRGD
YQFDIHASMTQLHKNLNFQLPFYGFRFNYTRLSLNGYLEFSDPPEYLTYPLVFPIKDWPA
KRDPSFMGIFFSKCRVGRIYPSDIDQRTPGVYFRVERDLMGRTDRFGVEVRERTMWDIRQ
GVVGADTFIPKHVVIATWKNVSFAGGIDNSLYTTNTFQMVLATDEVYTYIIFNYAVLNWL
SHTEAGGDTTKGEGGVPAYVGFNAGNGTQAYEYNPYSQNMVIRDLANRGWANGFPGRHIF
RVDEQILIGSCNKDIDAALLPLTFAPESGNMLGGQVVNITGPCFDPAIRVTCHFDTESVL
GTYVDRNRVICVQPYLKAEGYIRFQISVGTQRFKWRGKYFVETPAAATEKIFFTTDDVHK
KNPAEIRITWNQYNLTSNANANVMISLWGYRETKIEPQLEYIDVIEASYSNSGSYVITPS
NYINRNNINRDMQFGFLQINLTQPDQYSGLAISPVLWSRPIPLAWYMAPQWERQHGKRWA
RALCDNWIRADRFLRNFAADLPLCPCTLDQAVLDKGRFRPDRECDKDSNPSCLRHRGAIH
CVVSGTPVAQGAEQQCCYDRYGFLMLTYDQMWGSRPRRVHNLGKMPWNEASKVPSLSMWF
HDMRPFYSCCYWQEEQAVGCETYRFERRPSQDCVAYQAPGIAGVFGDPHFVTFDGTAYTF
NGLGEFVLARSVDESNKFEVQGRFEQLPVNYYGEVKATQLTAVAMRGNTTTTIEVRLRPL
HARWRYRLDVLADGRRVYFDRESLKFQHFDGVTVYTPTYLLNQSQVVVQFDAGIGVEVVE
NEGYMTGRVFLPWKFINKTAGLFGNWSFNKLDDFMLPNGQVAQLNLNDLRSIHTNFGIKW
MLTDREVPGVGAALFKREFGRMSGYYANATFQPNYVLDPADFLPANRSYDLERAEELCGE
CMQCQYDYAMTLNRDLAHFTKNYYDTIVNMQAENAVRVVSCGVLQTPRFGRKLSFDFMPG
AKVSFECNEGFILIGDQRRECLSNGLWNIPEYGYTECLREVYYTRRVAFIAIGIIFLVIC
PLMLCIVCGVYRYRQKQLKEDPQWQMPMLPRSRASSARNLRTLNYDDDSDTDASTLKKSR
SYDKVYRTNEPLPGKPQIDFPAKKWDLDENDEDVTSSEGEKPKQLGRRSLHSASGTELDQ
HGSPVDGDHPDEDDDFDEADVHTGTTHPVGYHQPLSPEEADQLHRQQYSPTFSGLDSRTS
GASSINYTPQAATQNRFGGVPVLPSNTQYYSRPPSSVNTVPLRTAPTPLTQDTGLPSPPL
ATSPTPSVQKSTEV
NT seq 4365 nt   +upstreamnt  +downstreamnt
atgcgtttcaaactgtttgtggtttgtgcgctggcctgcgggtttatggcctttgtcctg
gctaacgagaatatatcgacggaggagttcgaggatcaaataatcaatgcagttccggag
ccggtcaaggtgactaagcccaaagctcaggcggaattcgttgaggttccaaaggccacg
cccgctcccaaaaaagcggaagcggacaacccgaaaaccaaaccactggccctgcagaag
cccactctgattcccgtggtgcatgtcagcagtcggggaacagatgatatcctcaccgtc
gcgggactgaagcccgagaaaatgttcggagccctcatcatgccaaatgactatttgggg
gagctgtacgacgtggacaacagcggctacaattgggatcccaataacaatgtcgccccg
ccgaccacatactccacggcagccggaggatacaccataaccgccgcccgtcttgcggag
ctcaggagcaactttatgtactggtacttcgacaaggacatgtacggaggacgtggcgac
taccagttcgacatccatgcctccatgacgcagctgcacaagaatctgaacttccagctg
cccttctacggcttccgattcaactacaccaggctttccctcaacggctacttggagttc
tcggatccgccagagtacctaacttaccccctggtctttccgatcaaggactggcccgcc
aaacgcgatccctccttcatgggcatcttcttcagcaagtgccgtgtaggacgaatttat
ccatcggatattgaccagcggacgcccggtgtttacttccgagtggaacgtgatctgatg
ggacgtacggaccgattcggcgtggaggtgcgggaacgcaccatgtgggacatccgtcag
ggagtcgtgggcgccgataccttcatccccaagcacgtggtgatcgccacctggaagaac
gtctccttcgccggtggcatcgacaactccctctacacgacaaacaccttccaaatggtc
ctggccactgacgaggtctacacctatattattttcaactatgccgttctgaactggctt
tctcatactgaggccggaggtgatacgacgaagggcgagggtggtgttcctgcatatgtc
ggattcaatgccggtaatggaacccaggcgtacgagtacaatccctacagtcagaacatg
gtgattcgcgacctggccaacagaggttgggccaacggattcccgggtcgccacattttc
cgcgtggacgagcagattctaattggctcctgcaacaaggatatcgatgctgctctgcta
cctcttacctttgcccccgagtctggtaatatgctgggtggtcaagtcgtcaatatcact
ggaccctgctttgatccggccatcagggtgacgtgccacttcgatacggagtccgtgctg
ggaacctatgtggatcggaaccgcgtaatctgtgtgcagccctacctgaaggccgagggc
tatatccgattccagatctccgtgggaacccagaggttcaagtggcgcggaaagtacttc
gtggagaccccggctgccgccaccgagaagatcttcttcaccaccgatgatgtgcacaag
aagaaccccgccgagatccgcatcacctggaaccagtacaatttgacctcgaacgccaat
gccaacgtgatgatctcgctgtggggctaccgggagaccaagatcgagccgcaactggag
tacatcgatgtgatcgaggcctcctactcgaatagcggcagctacgttatcacgccctcg
aactacatcaaccgcaacaacatcaaccgggacatgcagttcggattcctccagatcaat
ctcactcagcccgatcaatactcaggattggccatcagtccggttctctggtcccggccg
attcctctggcctggtatatggcgccccagtgggagcggcagcatggaaagcgatgggcg
cgggctctctgcgataattggattcgcgccgaccgattcctcaggaactttgcggccgac
ctgccactttgcccctgcaccttggaccaggctgtcctggacaaaggacgcttccgccct
gaccgcgagtgcgacaaggactcgaaccctagctgcctgcgtcatcgcggggccatccac
tgcgtggtcagtggaacgccagttgcccaaggagctgaacagcagtgctgctacgatcgt
tatggcttcctgatgctgacctacgaccaaatgtggggctctcgtccccgtcgcgtccac
aacctgggcaagatgccctggaacgaggccagcaaggtgccctcgctgtccatgtggttc
cacgacatgcgccccttctactcctgctgctactggcaggaggagcaggcggtgggctgc
gaaacctaccgcttcgagcgtcgtccctcgcaggattgtgtggcctatcaggcgcctgga
atcgcaggtgttttcggcgatccccactttgtgacctttgatggcacggcttacacattc
aacggactgggagaattcgtcctggcacgcagcgtggatgagagtaataagtttgaggtc
caaggacgattcgagcagctgccagttaattattatggcgaggtgaaggccacccagttg
acagcggtggccatgcggggaaacaccaccacgacgattgaggtccgtctgcgccctctg
cacgccagatggcgctatcgcctggatgtcctggccgatggacgaagggtttacttcgat
cgtgagagtctgaagttccagcacttcgacggtgttaccgtgtataccccgacttacctg
ctcaatcagtcgcaggtggtggtgcaattcgatgctggtatcggagtggaggtggtagag
aacgaaggatacatgaccggtcgcgtcttcctgccatggaagtttataaacaaaaccgcg
ggactctttggcaactggagttttaataaactagacgactttatgctgcccaatggacaa
gtggcccaactcaatcttaacgatctgcgcagcattcataccaactttggaatcaaatgg
atgctcacggatcgcgaggttcctggagtgggagccgctctatttaaacgagaatttgga
cgaatgtctggttactatgcgaatgccaccttccagccgaattatgtcctagatcctgcg
gacttcctgccagcgaatcgctcttacgatcttgaaagagctgaagaactttgtggagag
tgtatgcagtgccagtacgattacgcaatgactttgaatagagacttggcacactttacc
aaaaattactacgatactatagtcaatatgcaggcggaaaatgcagtgcgtgtggtatcc
tgtggagttctgcagactcctcgttttggtcgaaagctgagctttgactttatgcctggt
gcgaaagtatcctttgagtgtaacgagggctttatcctgattggagatcaacgtcgtgag
tgcttgtcgaacggtctgtggaacattccggaatacggatataccgaatgtctacgtgag
gtgtactacacgcgtcgcgtcgctttcatagcaattggcattatcttcctggtgatctgc
ccactgatgctgtgcatcgtgtgtggagtatatcgctatcgccagaagcagctcaaggag
gatccgcagtggcagatgcccatgctgccccgttcgagggctagttcggctcgtaattta
aggacacttaactacgacgacgacagcgatacggatgccagcacattgaagaaaagtagg
tcctacgacaaagtatatcgcacgaacgaaccattaccgggcaaaccgcaaattgatttt
ccagctaagaaatgggatctggatgagaacgacgaggatgtgacctcatcggaaggtgag
aagccgaaacagctgggtcgccgctccttgcactccgcctccggaacggagttggatcag
catggctccccggtggacggggatcatccagacgaggacgatgacttcgacgaggcggat
gtccacacgggcaccactcatccagtcggataccaccagcccctgtcgccggaggaggcg
gatcagctgcatcgccagcagtacagccccaccttcagtggcctggacagtcgcaccagt
ggcgccagttccataaactacaccccacaggcggcgacgcagaaccgcttcggaggagtg
ccggtgctgcctagcaacacccagtactacagtagacccccgtcgagcgtgaacaccgtg
ccgctccgtactgcgcccacgcccctgacgcaggacactggtctgccttcgcctcccctg
gccacctcgcccactccctcggtgcagaagtccacggaggtctga

DBGET integrated database retrieval system