KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31033
Entry
Dmel_CG31033      CDS       T00030                                 

Gene name
Atg16
Definition
(RefSeq) Autophagy-related 16, isoform F
  KO
K17890  autophagy-related protein 16-1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04136  Autophagy - other
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG31033 (Atg16)
   04136 Autophagy - other
    Dmel_CG31033 (Atg16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG31033 (Atg16)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG31033 (Atg16)
Membrane trafficking [BR:dme04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Dmel_CG31033 (Atg16)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    Dmel_CG31033 (Atg16)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dmel_CG31033 (Atg16)
SSDB
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 WD40_like
Other DBs
NCBI-GeneID: 326115
NCBI-ProteinID: NP_001138124
FlyBase: FBgn0039705
UniProt: B7Z0R7
Position
3R
AA seq 612 aa
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLKISVENEQLRN
AVSTGGTGSNVAIATLEKKLLSQQEELTELHKRKGENSQMIVDLNQKVEQQRIIISEKEH
SLVEQQTNNNRLRAEVQLLHSSLEELKKLNNTMLDEHTALQLAFSSLEEKLRGVQDENRR
LLERLMQYKSKDADKLNEENESIIRKRLPSIFRKRSAKLKRDLEDAVREPSSSSNAASSP
GAASLQRNSSPAQFVGGLIGDEDFDEAAINGAMEAIGLDDNEYISARFTAGEIAENSRAS
IDTLKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNST
EPRAVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKY
VQEPIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRF
WDIRTEKQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKI
SCDFARASFNSSGLKIACGSADGAIYIWNVNGFLEATLKGHSTAVNAVSWSPNNNMLASV
GKNKRCTIYSES
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgtctacggaggagcatgtgtggcgagcgcacgtcgtgcggcgcttacgcgagcgaaat
cgcaaggagtgcgacaacttcaaggagatcatcgagcaaaacaaccgactgattgaccat
gtggcgcaactgaaggcggacaacctgaagatctccgtcgaaaacgagcagctccgcaac
gcggtgtcaacaggtggcaccggctccaacgtggctatcgccaccctcgaaaagaagctg
ctcagccagcaggaggagctcacagagctacacaagcgcaagggcgagaactcccagatg
atcgtggacctcaaccagaaggtcgagcagcagaggatcataatttccgagaaggagcac
agcctcgtcgaacagcaaacgaacaacaaccgattgcgcgcggaggtgcagctacttcac
tcgagtttggaggaactcaagaagctgaacaacacaatgctggacgaacatacggcgctt
caattggcatttagctccctcgaggagaagttaaggggagtgcaagatgaaaatcggcgt
ctactggagcgacttatgcaatacaagtcaaaggatgccgacaagttgaacgaggaaaac
gagagcataattagaaaaagactgccgtcaattttcaggaaacgttcggctaaactgaaa
cgtgacctagaagacgcggttcgtgagcccagttcgtccagcaacgccgcctcctcgccc
ggcgccgcatccttgcagcgcaactccagtcccgcccagttcgttggcggcctcatcggc
gacgaggatttcgacgaggccgcgataaatggcgccatggaggccataggtctcgatgat
aatgaatatattagcgctcgttttacagcaggcgaaatcgccgagaactcgcgggcttcc
atcgacaccctgaaggccacgggctacctgggccaggccaatcccaccaagatcctcatg
aagttcgaggcccacgagaacgagtcgcacgcggtgcgctggagtcccgtggagcgcatg
gtggccaccggtggcgctgatcgcaaagtcaaactttgggacattggcaaaaattccacc
gaaccacgtgccgttctaagcgggagcagtgctgggattaactccgtagatttcgattcg
acaggcgcctacatcctgggcacctccaatgactacggagccagagtatggacagtgatg
gacaatcgcttaagacacacgctgacgggtcacagcggcaaggtaatggccgccaagtac
gtccaggagcccatcaaagtggtgaccggtagccacgatcgcacactgaagatctgggat
ttgcgcagcatcgcctgcatagagacgaagttcgccggctccagctgcaatgatctagtc
accaccgacagcctcggatcaacgatcatcagtgggcactacgataagaagatccggttc
tgggacatacgcaccgagaagcaggcggacgacgtcttaatgccggccaagatcacctct
ttggatttgtcaaaagattgcaattacctcatatgctctgtaagagacgatactattaaa
ctgttagatttacgcaagaaccaagttatatccacgtttacaaacgaacactttaagatc
agctgtgattttgctcgagcttctttcaactcgagcggcctaaagatcgcttgtggatca
gcggatggcgctatatacatttggaatgtgaatgggttcctggaagccacactcaaggga
cacagcaccgccgtaaacgcggtcagttggagtcccaacaacaacatgctggcctccgtg
ggaaagaacaagcgctgcaccatctactcggagtcatag

DBGET integrated database retrieval system