KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3114
Entry
Dmel_CG3114       CDS       T00030                                 

Gene name
ewg
Definition
(RefSeq) erect wing, isoform C
  KO
K11831  nuclear respiratory factor 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG3114 (ewg)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    Dmel_CG3114 (ewg)
SSDB
Motif
Pfam: Nrf1_DNA-bind DUF5352 DUF2841
Other DBs
NCBI-GeneID: 30975
NCBI-ProteinID: NP_001014711
FlyBase: FBgn0005427
UniProt: Q24312
Position
X
AA seq 733 aa
MATTSYRLVVAPAGSQRSSTGNVVVTTTSSGSHSSNGANGGTGGTSAGSSTLGSGLNVTT
ITATSGGQLQSAGNTSQSNGTTYKIEMLEEDIQSLGSDDDDEDLISSDGSLYEGDLGSMP
VNDDVAHQLAAAGPVGVAAAAAIASSKKRKRPHCFETNPSVRKRQQNRLLRKLRAIIYEF
TGRVGKQAVVLVATPGKPNTSYKVFGAKPLEDVLRNLKNIVMDELDNALAQQAPPPPQDD
PSLFELPGLVIDGIPTPVEKMTQAQLRAFIPLMLKYSTGRGKPGWGRESTRPPWWPKELP
WANVRMDARSEDDKQKISWTHALRKIVINCYKYHGREDLLPTFADDEDKVNALISQSGDE
DEDMELSNPPTIHTVTTMTPPTGNSNQPQQVNVVKINSAGTVITTHTAQSNTPAPTIIQS
TNNQHVTTTATLPASTKIEICQAPAQNQQHHQHHQTHLPNAVHIQPVAGGQPQTIQLTTA
SGTATATAVQTTAAAVSAAQAHAHSQSQAHSQSSANQTVTAQQIANAQVCIEPITLSDVD
YTTQTVLSQNADGTVSLIQVDPNNPIITLPDGTTAQVQGVATLHQGEGGATIQTVQSLTD
VNGHENMTVDLTETQDGQIYITTEDGQGYPVSVSNVISVPVSMYQSVMANVQQIQTNSDG
TVCLAPMQVENGDQLETITMSPGMHQMMIQGGPGQEPQLVQVVSLKDATLLSKAMEAINS
GNVKSEDTIIMEQ
NT seq 2202 nt   +upstreamnt  +downstreamnt
ctggccaccacaagctatcggctagtcgtggcgccggcgggcagccaaaggagttcgact
ggaaatgtggttgtcaccaccacctcctcgggtagtcactcctcgaatggggctaacgga
ggtacaggaggaacttctgccgggagcagcactttgggaagcggcctcaacgtgactaca
ataacagcaaccagcggcggccagctgcaaagtgccggcaacacttcccagagcaacgga
accacctacaagatcgaaatgctggaagaggatatccagagcttgggctccgacgatgac
gacgaggatctaatcagcagtgatggcagtttatacgagggagatctgggttccatgcca
gtgaatgatgatgtggcccaccaactagcggccgcaggaccagtaggcgtggcagcagcg
gcagcaatagcgagttctaaaaagcgaaagagaccccattgtttcgaaacgaatccctcg
gttagaaaaaggcaacaaaatcgattgttgcgcaagctgagagctattatctatgagttt
acgggcagagtgggcaaacaagcggtagttttggtggcaacaccgggtaaacccaacaca
agctataaggtttttggagccaaacccctggaagatgtgttgcgcaacctaaaaaacatt
gtaatggatgaactggacaatgcactggcccagcaagctccccctccgccccaagatgat
ccatcgctcttcgaacttcctggcttggtaatcgatggtattcccactcccgtagaaaag
atgacccaagcgcagctaagagcctttattccgctgatgctcaagtattctacgggacga
gggaagccaggatggggcagggagtctaccagaccgccctggtggccaaaggagctaccc
tgggccaatgtgaggatggatgcccgttcagaggatgacaaacagaagatcagctggaca
catgctctacgcaagattgtgatcaactgctacaagtaccatggaagggaggatctgctg
cccacctttgccgatgacgaggataaggttaacgcgttgatttcgcaatcgggcgacgaa
gacgaggacatggagctttcaaatcctcctaccatccacacggtgacgacaatgacgccg
ccgacgggcaacagcaatcaaccgcagcaggtgaatgttgtgaaaatcaatagtgctgga
acagtgatcaccacccacacggcccaaagcaacactcctgctccgacaatcatccagagt
accaataaccagcatgtgaccacgacggctacgctgcccgcctctacaaagattgagatt
tgccaggcgccggctcagaatcagcagcaccatcagcaccaccagacgcacttgcccaac
gctgttcatattcagccagtggccggaggacagccgcaaacaatccagttgaccactgcc
agtggaacggcgaccgccacagcggttcagacgacagccgccgccgtaagtgcggcacag
gctcacgcgcattcgcagtcccaggctcactcccagtcgagtgctaaccagacggtcact
gcccagcagatcgccaatgctcaagtctgcatcgagccaattacgctcagcgatgttgat
tacaccacgcaaacggtcctctcacagaacgccgatggtaccgtatcgctaatccaggta
gacccaaataatccaattatcacactgccggatggtacaactgcccaggttcaaggtgtt
gccacgctccaccaaggtgaaggcggtgctaccattcaaaccgttcagagtctcactgat
gtaaatggtcatgagaacatgaccgtagatctcaccgagacacaggatgggcaaatatat
attacaacggaggatggccaaggatatcccgtttcggtgagcaatgtgatctcagttccc
gtctctatgtaccagtcggtaatggccaacgtgcagcagatccagacgaacagcgatgga
acagtgtgcctcgcgccgatgcaggtggagaatggcgaccagctggagaccatcaccatg
tcgcctggaatgcaccagatgatgatccaaggaggtcctggccaagagccgcagctggtc
caggtggtcagcttaaaggatgccactctgctaagcaaggctatggaggccattaattcc
ggcaacgtaaagtccgaagacacgattattatggaacaatag

DBGET integrated database retrieval system