KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31196Help
Entry
Dmel_CG31196      CDS       T00030                                 

Gene name
14-3-3epsilon
Definition
(RefSeq) 14-3-3epsilon, isoform A
  KO
K06630  14-3-3 protein epsilon
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway -fly
    Dmel_CG31196 (14-3-3epsilon)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG31196 (14-3-3epsilon)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG31196 (14-3-3epsilon)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    Dmel_CG31196 (14-3-3epsilon)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG31196 (14-3-3epsilon)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3
Motif
Other DBs
NCBI-GeneID: 42186
NCBI-ProteinID: NP_732309
FlyBase: FBgn0020238
UniProt: P92177 C6TP70
Position
3R
AA seq 262 aa AA seqDB search
MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASW
RIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVF
YYKMKGDYHRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEV
DPNAGDGEPKEQIQDVEDQDVS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgagaacaatgtgtacaaggcaaagctggccgaacaggccgagcgctac
gacgaaatggtggaggccatgaagaaggtcgcctccatggacgtagagctgaccgtcgag
gagcgaaatctgctgtcggtggcgtacaagaatgtgattggagcacgccgtgcctcgtgg
cgcatcatcacctcgatcgaacagaaggaggagaacaagggggccgaggagaaattggag
atgatcaaaacctaccgcggacaggtggagaaggagctgcgcgacatctgctcggatata
ctgaacgtgctcgagaagcatctcattccatgcgccacatccggcgaaagcaaagtattc
tactataagatgaagggcgactaccatcgctacctggccgaattcgccaccggctccgac
cgcaaggatgcggcagagaactcgctgattgcctacaaggcggccagcgatattgccatg
aacgatctgccaccaacacaccccatccgtttgggcttggcattgaacttctcggtgttc
tactatgagattctcaactcgccggaccgcgcttgccgcttggcgaaagccgctttcgat
gatgccattgccgagttggatacactgagcgaagagagctacaaagactcgacactcatc
atgcagctgctgcgcgacaacctcacattatggacgtccgatatgcaggcagaagaagta
gaccccaacgcaggtgatggcgagcccaaagagcaaatccaggatgttgaggatcaggac
gtgtcgtaa

DBGET integrated database retrieval system