KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31201
Entry
Dmel_CG31201      CDS       T00030                                 

Symbol
GluRIIE
Name
(RefSeq) glutamate receptor IIE
  KO
K05313  glutamate receptor, ionotropic, invertebrate
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG31201 (GluRIIE)
Ion channels [BR:dme04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   Dmel_CG31201 (GluRIIE)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF4227 Peripla_BP_6 TMEM132D_C
Other DBs
NCBI-GeneID: 318623
NCBI-ProteinID: NP_001036733
FlyBase: FBgn0051201
UniProt: Q0KI42
Position
3R:complement(20644154..20648716)
AA seq 897 aa
MFFNHFVILWSLFSIHISVNWAQYENFGGYDNYQSLESVPIGLLTDQNTEQMNIVFDHAI
DVANQEVGTSLTSLKEEVNYGDAYQSYGKLCRMLETGIAGVFGPSSRHTAVHLMSICDAM
DIPHIYSYMSENAEGFNLHPHPADLAKALYSLITEFNWTRFIFLYESAEYLNILNELTTM
LGKSGTVITVLRYDMQLNGNYKQVLRRVRKSVDNRIVVVGSSETMPEFLNQAQQVGIINE
DYKYIIGNLDFHSFDLEEYKYSEANITGLRLFSPEKMAVKELLMKLGYPTDQDEFRNGSC
PITVEMALTYDAVQLFAQTLKNLPFKPMPQNCSQRTESVRDDGSSFKNYMRTLRLTDRLL
TGPIYFEGNVRKGYHLDVIELQPSGIVKVGTWDEDRQYRPQRLAPTTAQFDSVDNSLANK
TFIILLSVPNKPYAQLVETYKQLEGNSQYEGYGVDLIKELADKLGFNFTFVNGGNDYGSY
NKSTNESTGMLREIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQKATPE
LFTFMDPFSEEVWWFLGFSFLGVSLSFFILGRLSPSEWDNPYPCIEEPEELENQFTLGNS
IWFTTGALLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSV
DDLADNKDGVVYGAKKTGSTRNFFMTSAEERYKKMNKFMSENPQYLTEDNMEGVNRVKTN
THYAFLMESTSIEYNTKRECNLKKIGDALDEKGYGIAMRKDWPHRGKFNNALLELQEQGV
LEKMKNKWWNEVGTGICATKEDAPDATPLDMNNLEGVFFVLLVGSCCALLYGIISWVLFV
MKKAHHYRVPLRDALKEEFQFVIDFNNYVRVLKNSASIYSRSRQSSMSVASVAQESQ
NT seq 2694 nt   +upstreamnt  +downstreamnt
atgtttttcaaccattttgtaattttgtggagcctttttagcattcacatttcagttaac
tgggctcagtatgagaactttggcggatacgataactaccaaagtttggaaagtgtcccc
ataggtctgctcaccgaccagaacaccgagcagatgaacatagtcttcgaccatgccatc
gatgtcgccaaccaggaggtgggcacatccttgacgtcgctcaaggaggaggtcaactac
ggtgatgcctaccagagctacggcaagctgtgcaggatgctagagactggcatcgctgga
gtgtttggaccctcgtcgcggcatacagccgtccacctgatgtccatatgcgacgccatg
gatataccccacatctactcgtacatgagcgagaacgcggagggattcaatctgcatccg
catcctgctgacctggccaaagccctatacagcctaatcactgagtttaactggactcgc
tttatttttctctatgagtcagccgagtatctaaacattttgaacgagctaaccacgatg
ttaggaaagagcggaactgtaataacggtgctgcgatacgacatgcagttgaatggcaat
tacaaacaggtcctccggcgggttcgaaagtccgtggataatcgaattgtggtcgtgggc
tccagcgaaacgatgccagagttccttaaccaggcgcaacaagtgggcatcatcaacgag
gattacaagtacattatcggcaacctggactttcactctttcgatttggaggagtacaag
tacagtgaggccaatataaccgggcttcgtttattttctccggaaaaaatggccgtcaag
gaactgctcatgaagttgggttaccccaccgatcaggatgagttcagaaatggttcttgt
cccataaccgtggaaatggctctaacttacgatgccgtccagctatttgcacagacccta
aagaaccttcccttcaagccgatgccccagaattgctcccagagaacggaaagtgtccga
gatgatggttcctccttcaagaattacatgcgaactctgcgcctcacggatcgcttgctt
acgggacccatttacttcgaaggaaatgtccgcaagggctaccacctggatgtcatcgaa
ctgcagccgtcgggtatcgtcaaggtgggcacatgggacgaggataggcagtacagacca
cagcgactggcacccaccaccgcccaattcgatagcgttgacaattcgctggccaataag
actttcattatcttgctctcggtaccgaacaaaccatatgcccagctggttgagacatac
aagcagctggagggcaacagccagtatgagggctacggcgtggatctgatcaaggaactt
gccgataagctaggatttaattttaccttcgtaaacggaggcaatgactatggatcgtac
aacaaatccaccaatgaatccacgggcatgttgagggagataatgacggggcgagctgac
cttgccatcacggatttgaccatcacctcggagcgtgaacaggctttagactttaccatt
cccttcatgaatctgggcatcgccatactctatttgaagccccagaaagccacacctgag
ctttttaccttcatggatcctttttcggaagaagtctggtggttcctaggtttttccttt
ttgggcgtgtccttgagtttcttcatattgggtcgtctgtcgccgagtgaatgggataac
ccgtatccttgtattgaggagccagaagaactggaaaatcagttcacactaggcaactcg
atttggtttacaactggtgctctgcttcagcaaggttccgaaattggtcccaaagcttta
tccactcgaactgtagccagtttctggtggttttttaccctgatcgtggtatcttcctac
accgccaacttggctgcctttttgaccatcgaaaagccgcaaagtttaatcaacagcgtc
gacgatctggccgataacaaggatggtgtagtttacggtgcaaagaaaactggatccacc
aggaacttctttatgacatctgcggaagaacgctataaaaagatgaataaattcatgtcc
gaaaatccgcaatacctcaccgaagacaacatggagggagtgaatcgagttaagaccaat
actcactacgcatttctgatggaatccacttccattgagtataataccaagcgtgaatgc
aatcttaaaaagattggagatgcattagacgagaaaggctatggaatagccatgcggaag
gattggccgcatcgcggtaagtttaacaatgcacttctggagctgcaggaacagggagtg
ctggagaagatgaagaacaagtggtggaacgaggtgggtaccggcatttgcgccaccaaa
gaggatgctcccgatgcgacacctttggacatgaataacctggagggagtttttttcgta
cttcttgtcggaagttgctgcgccctgctttacgggattatcagctgggttttgttcgta
atgaagaaagctcatcactaccgagttccgctgcgtgacgctctcaaggaggagttccag
ttcgttatcgatttcaataactatgtacgggtattgaaaaactccgcttccatctactcg
cgcagtcgccagtcctcgatgtcagtagcttctgtggcccaggaatcgcagtag

DBGET integrated database retrieval system