KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3139Help
Entry
Dmel_CG3139       CDS       T00030                                 

Gene name
Syt1
Definition
(RefSeq) synaptotagmin 1, isoform A
  KO
K15290  synaptotagmin-1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3139 (Syt1)
Membrane trafficking [BR:dme04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    Dmel_CG3139 (Syt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 Podoplanin RIFIN Glycophorin_A FeoB_associated DUF4083 DUF997 DUF1180 DUF2621 BSMAP DUF4834 EphA2_TM DUF347 DUF4446 MAP17
Motif
Other DBs
NCBI-GeneID: 33473
NCBI-ProteinID: NP_523460
FlyBase: FBgn0004242
UniProt: P21521
Position
2L
AA seq 474 aa AA seqDB search
MPPNAKSETDAKPEAEPAPASEPAADLESVDQKLEETHHSKFREVDRQEQEVLAEKAAEA
ASQRIAQVESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIII
LVFLVVFGIIFFCVRRFLKKRRTKDGKGKKGVDMKSVQLLGSAYKEKVQPDMEELTENAE
EGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDK
KKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLC
TIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGL
SDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRI
GTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETDEILKNMK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaatgcaaaatcggaaacggacgccaaaccggaagcggaaccagcgccagcg
tctgagccggcagcggatctggagtccgtggaccagaagctggaagaaacacatcactcc
aaattccgtgaagtggacaggcaggagcaggaggtgctcgccgagaaggcggcggaagcg
gccagtcaaagaatcgcacaggtggaatcaacaacacggagtgctaccacagaggctcag
gaatccaccaccaccgcagtgccggtgatcaaaaagatcgagcatgtcggcgaagtggtc
accgaggtgatcgcggagcgcacggggctgcccacatggggcgtggtggccatcatcata
ctcgtgttcctcgtcgtctttggtataatcttcttctgtgtgcggagattcctgaagaag
cgaagaaccaaagatggaaagggtaagaagggtgtcgacatgaagtcggtacagttgttg
ggatcggcgtacaaggagaaagttcagcctgatatggaggaactcaccgaaaatgccgag
gagggtgacgaggaggacaagcagagcgagcagaagctggggcgcctcaacttcaagctg
gaatacgatttcaactccaacagtttggccgtgacggtgatccaagccgaggagcttccc
gccctggatatgggcggtacctcggatccctatgtcaaggtgtacttgctgcccgacaag
aagaagaagttcgagaccaaggtgcaccgcaagacactgagtccggtcttcaacgagacg
ttcacctttaagagtttgccctacgccgatgccatgaacaagacgctcgtgtttgccatt
ttcgacttcgatcgcttctcgaagcacgaccagatcggcgaggtgaaggtgccgctgtgc
accatcgatctggcgcagacaatcgaggagtggcgcgacctggtcagcgttgaaggagag
ggcggacaggaaaagctgggagatatctgcttctcgctgcgctacgtgccgaccgccgga
aagctaaccgtcgtcatcctagaggccaagaacttgaagaagatggacgtgggcggattg
tctgatccatatgtgaaaattgcaatcatgcaaaatggcaaacgtttgaaaaagaagaag
acaagtatcaaaaaatgcaccctcaacccttactataatgagtcgttctcatttgaagta
ccatttgaacaaatacaaaaaatctgtctcgttgtgaccgtcgtggactacgatcgtatt
ggcacctccgaacccatcggccgctgcatacttggctgcatgggcaccggaaccgagctg
cgtcactggtcggacatgttggcctcgccccgccggcccatcgcccagtggcacaccctc
aaggatcccgaggagaccgacgagatcctgaagaacatgaagtaa

DBGET integrated database retrieval system