KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3143Help
Entry
Dmel_CG3143       CDS       T00030                                 

Gene name
foxo
Definition
(RefSeq) forkhead box, sub-group O, isoform C
  KO
K09408  forkhead box protein O3
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04068  FoxO signaling pathway
dme04137  Mitophagy - animal
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG3143 (foxo)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG3143 (foxo)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG3143 (foxo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG3143 (foxo)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    Dmel_CG3143 (foxo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead FOXO-TAD DUF916
Motif
Other DBs
NCBI-GeneID: 41709
NCBI-ProteinID: NP_996204
FlyBase: FBgn0038197
UniProt: Q95V55
Position
3R
AA seq 613 aa AA seqDB search
MMDGYAQEWPRLTHTDNGLAMDQLGGDLPLDVGFEPQTRARSNTWPCPRPENFVEPTDEL
DSTKASNQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQ
IYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKP
GKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESP
LHSGGGFQLSPDFRQRASSNASSCGRLSPIRAQDLEPDWGFPVDYQNTTMTQAHAQALEE
LTGTMADELTLCNQQQQGFSAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASG
YNTLQPQSQCLLHRSLNCSCMHNARDGLSPNSVTTTMSPAYPNSEPSSDSLNTYSNVVLD
GPADTAALMVQQQQQQQQQQQLSASLEGQCLEVLNNEAQPIDEFNLENFPVGNLECNVEE
LLQQEMSYGGLLDINIPLATVNTNLVNSSSGPLSISNISNLSNISSNSGSSLSLNQLQAQ
LQQQQQQQQAQQQQQAQQQQQQHQQHQQQLLLNNNNNSSSSLELATQTATTNLNARVQYS
QPSVVTSPPSWVH
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggctacgcgcaggaatggcccaggctgacccacacagataacggcctggcc
atggaccagctgggcggggatctgcccctggacgtgggcttcgagccacagacccgggcc
agatccaacacatggccatgtccgcgtcccgaaaactttgtggagcccaccgacgagttg
gacagtacaaaggccagcaatcagcagttggccccaggagactcacagcaggctatacag
aatgcgaatgcagccaagaagaactcatcgcgtcgcaatgcatggggaaatctatcctat
gcggatctcatcacgcatgccattggatcggccaccgacaaacgattgacactgagtcag
atttacgagtggatggtccagaatgtgccatatttcaaggacaagggcgattcgaatagc
agtgccggatggaagaactccatacgtcacaatctgtcgctgcacaaccgctttatgagg
gtccaaaacgagggcaccggcaagtcatcctggtggatgctcaacccggaggccaagccc
ggcaagtctgtgcgccgccgtgccgcttccatggagacgtcccggtacgagaagcggcgc
ggcagggccaagaagcgggtggaggcactgcgtcaggcgggcgtggtgggcctcaacgat
gccacgccctcgcccagcagcagcgtcagcgaggggctggatcactttcccgagagtccg
ctccacagtggcggtggcttccaattatcgcccgatttccggcaacgcgcctcatccaat
gccagttcctgcggacgcctgagccccattagggcgcaggatcttgagcccgactgggga
ttccccgttgactaccagaacacaacgatgacgcaggcccacgcccaggcgctcgaggag
ctgacgggcacaatggcggatgagctgacgctgtgcaaccagcagcagcaagggttcagt
gccgcctcgggacttccctctcagcccccgcccccgccctatcagccgccgcagcatcaa
caggcgcagcagcagcaacagcagcagtcgccctacgccctcaacggccccgcctccggc
tacaacacgctgcagccgcagtcgcagtgcctgctgcaccggtccctcaattgcagttgc
atgcacaatgcaagagatggtctctcgccgaactcagtaaccacaacaatgtcgcccgcc
tatccaaacagcgagccctcatcggactccctgaacacgtacagcaacgtggtgctcgat
ggtccggcggacactgcggcactgatggtgcagcagcagcagcagcagcagcaacagcaa
cagctgtccgccagcttggaaggacaatgcctggaggtgctcaataacgaggcgcagccg
atagacgaatttaatctggagaactttcccgtgggcaatctcgagtgcaatgtcgaggag
ctgctgcagcaggagatgagctacggcggcctgctggacatcaatataccgctggccacg
gtcaacacgaacctggtcaacagcagcagtgggcccctgagcatcagcaacattagcaac
ctcagcaacataagcagcaattccggcagcagtctcagtctgaatcagttgcaggctcag
ctgcaacagcagcagcagcagcagcaggcgcagcaacagcagcaggcgcagcagcaacaa
cagcagcatcagcagcaccagcaacagttgctgctaaataataacaacaacagcagcagc
agcctggaattggcaacacaaacggctaccacaaatctgaatgctcgggttcagtactca
cagcccagcgtggtgacctcgccaccatcctgggtgcactag

DBGET integrated database retrieval system