KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31673Help
Entry
Dmel_CG31673      CDS       T00030                                 

Gene name
CG31673
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored
Motif
Other DBs
NCBI-GeneID: 35348
NCBI-ProteinID: NP_001286110
FlyBase: FBgn0051673
UniProt: X2J9A5
Position
2L
AA seq 325 aa AA seqDB search
MSRATRAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVPGVDAIYWAHY
QPLNAGILDAAGSQLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMI
AAGRHFHAGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKI
IYHTRTRKENDGDFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFV
NVARGGLVNQTDLHDALTNGTISAAGLDVTTPEPLPANSPLLNVPNFILPHMGTQTMKTT
IEMGLLAANNILNAIEGKPMIRPAY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtgcgaccagggcttttaaagtgctgatttcgcatccaaatgtcccagcaccg
gctctggaactgctccgatcccgtggagcggagaccatcatctgccagagtgtgccgccc
tcgagggatgagatcctgcagaaggtgcccggcgtggatgccatctattgggcccattac
cagcccctgaatgccggaatcctggatgctgctggatcccagctgcgttgcgtgagcacc
atgtcctccggaatcgattttgtggatattccggagttccagaagaggggaatcccattg
ggccacactcccggggtggtgaaaaatgcagtggccgatctcgccattggcttgatgatt
gcagccggtcgtcactttcatgccggtcgcaccgaaatcgagaggtcccaatggaaaatc
gagcagatcaactggatgatgggtcaagagattcgcgattccgtcatcggtttctttggc
tttggcggtattagtcaggccatcgccaagcgattgcagtgctgggatgtggccaagatc
atctaccatactcgcacccgaaaggaaaacgatggcgacttcaaggcagagcatgtgtcg
tttgaacaacttttacaagaaagtgacttcctggtggtagctgctccacttacaaacgaa
actagagagaaattcaatggaaaggcatttaatctgatgaagaggagttctgtgtttgtc
aatgtggccagaggaggtctggtaaatcaaactgaccttcatgacgccctgacaaatggt
acaatttctgccgcaggcttggatgtgaccacaccagaaccactgcccgccaatagtcct
cttctcaatgtgcccaattttatccttccccatatgggcactcagacaatgaagactacc
attgaaatgggattgcttgctgccaataatattttgaacgccatcgaagggaagcccatg
ataaggccagcctactga

DBGET integrated database retrieval system