KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31674Help
Entry
Dmel_CG31674      CDS       T00030                                 

Gene name
CG31674
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored Shikimate_DH ThiF IlvN
Motif
Other DBs
NCBI-GeneID: 318878
NCBI-ProteinID: NP_001286111
FlyBase: FBgn0051674
UniProt: Q8INU6
Position
2L
AA seq 327 aa AA seqDB search
MSTTKPFKVLIAHTDVPPEGIEILKEQCEILQVINEPPKNRPEILEKIRGAHAVIWGGRD
ILNAEILDAAGPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIA
AARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRML
YTTRNRVSQDIEERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVL
VNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRR
TRVDAANLASRNVLKGLAGEPMLSPAY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacaaagccgtttaaagtgctgatagcacataccgatgttccgccagaggga
attgaaatcctgaaggagcaatgcgagatcctgcaagtaataaatgaacctccaaaaaat
cggcctgaaattctagaaaagatcaggggggctcatgccgttatttggggtggtcgggac
atactcaatgccgagattctggacgccgctggtccgcaattaaaggcggtatccaccatg
tcgtcggggataaacaatgtggatgtgccggagctaaagaaaaggggtatccccttggga
agtactcctgcgatgctgactgttgcggtagccgatcttacggtgggcctgttgatcgcc
gctgcccggaggttccaagagggtcgaaggaagatagacagtgataaatgggataaggac
catcttaactggatgctgggtcaggatatccgtgattccaccgtgggcttctatggcttt
ggaggcattggccaggcagtggctaagcgtttgatgggattcgatattaagcgcatgtta
tataccacccggaatcgcgttagccaggatatcgaggagcggttcaatgccaagaaggtg
gatttcgaaacgcttctggcggaaagtgatttcctcatcattgcatccccattgaccaag
gagacattgggattgtttaatgccaccgtctttaataaaatgaaagaaacggcagtactg
gtcaacgttggcaggggcaaaattgtcaaccaagatgatctttacgaggcgcttaaatca
aaccgaatttttgctgctggactagatgttatggatccggagccccttccttccaacgat
aaattacttactctagacaatgttgtggttactcctcatgtgggctatgccacccggaga
acccgtgttgatgcagccaatttggcttcgcgtaatgtgctcaaaggattggcaggagag
ccgatgttgtcacccgcctactaa

DBGET integrated database retrieval system