KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31675Help
Entry
Dmel_CG31675      CDS       T00030                                 

Gene name
CG31675
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: Activin_recp zf_PR_Knuckle
Motif
Other DBs
NCBI-GeneID: 318879
NCBI-ProteinID: NP_724298
FlyBase: FBgn0051675
UniProt: Q8SXV2
Position
2L
AA seq 148 aa AA seqDB search
MQHYLLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAFIAPPRFLEND
LLSVNATACLKRVFKENGVRKIVRGCYFGEVNATDVWCKMDPTLSAVQNSSCHVCDSENY
CNGSENHPVDKWKIFGSLVLFLLATQLL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattatttacttttgtttggcgcgctcatctcgctactggcctcagcttacgcc
atcaagtgctatgcctgcgaatccgtctacgaggctagttgcggcgacgacttcgaagtc
gagaaccattttaaatacgactgcgccttcattgctcctccgcgattcctggagaacgat
ctgctcagcgtgaatgccacggcctgtttgaaacgggtattcaaggaaaacggcgtgcgt
aagatcgtcagaggctgctacttcggcgaggtaaatgccaccgatgtgtggtgcaaaatg
gaccccaccctgtcggcggtgcagaactcaagttgtcatgtgtgcgacagcgagaactac
tgcaacggatcggaaaatcatccagtggataaatggaaaatcttcggcagtctggtcttg
tttctcttggcaactcaactactctga

DBGET integrated database retrieval system