KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3174
Entry
Dmel_CG3174       CDS       T00030                                 

Symbol
Fmo-2
Name
(RefSeq) Flavin-containing monooxygenase 2
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 NAD_binding_8 Lys_Orn_oxgnase AlaDh_PNT_C HI0933_like Shikimate_DH DAO FAD_binding_2 FAD_oxidored
Other DBs
NCBI-GeneID: 35561
NCBI-ProteinID: NP_610217
FlyBase: FBgn0033079
UniProt: Q7K3U4
Position
2R:complement(6642418..6645098)
AA seq 429 aa
MIKTSVDKRRVCVIGAGTAGLCALKNSLEAGLDAVAYERGTEIGGTWIFSEEMPKDEYDE
VHSSMYEGLRTNLPKEVMGYPDYSYPDDITESFITSNQVLEFLRSYAEHFKLKAHIKLQH
EVIRVRPRLDDWEVYVWDHSTDTCDPVYYDFVYVCNGHYTEPDLPEVEGLDLFEGNKMHS
HLYRKADKFKDARVLIIGAGPSGMDITNHVRLAAKQVFLSHHLSTTPNTAFMGNVTQKPD
VKRFTKDGAVFTDGSTESFDHVMFCTGYKYTFPCLSTDVGVQVIDNFVQPLWKHCININH
PTMAFVGLPFNVIPTHIFDMQVRFTLKFFTGQRKFPSREQMIADLEQEIGERWGCGVRNQ
KKAHQMGERQFVYYNELASIAGIENIKPVIHKLMKDCGKKYIFELDTYRSNKYTILDDEN
FLKNGEAIV
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgatcaaaacttcagtggacaagcgtcgtgtttgcgtaataggagctggaacagcgggg
ttgtgcgcgctgaagaactccctggaagcgggtctggatgcggtggcctacgaacgaggc
accgaaatcggaggaacatggattttctccgaggaaatgcccaaggacgagtacgacgag
gtgcacagcagcatgtacgaaggcctgcgcaccaatcttccaaaggaggtcatgggctat
ccggactactcgtaccccgacgatatcaccgagtctttcatcacctccaaccaggtgcta
gaatttctgcgctcctacgcggaacacttcaagctaaaggcccacatcaagctccagcac
gaggtgataagagtgcgtcctcgcttggacgactgggaggtctacgtatgggaccacagc
acggatacctgtgacccagtctactacgacttcgtttatgtctgcaacgggcactacacg
gaaccggacctcccggaagtcgagggattagatctgttcgagggcaacaagatgcacagc
cacctctaccgcaaggcagataagtttaaagacgcgcgtgtgctgatcattggcgccggc
cccagtggcatggacatcaccaaccatgttcgcttggctgccaagcaggtcttcctaagc
caccacctttccacgacccctaacacagcattcatgggcaacgtaacgcagaagccggat
gtgaaacgcttcacaaaggatggagccgtcttcacggacggcagcacggagagctttgac
cacgtgatgttctgcaccggctacaagtacacattcccctgcctcagcaccgatgtgggt
gtccaggtgatagacaacttcgtgcagccactgtggaagcactgcatcaacatcaaccac
ccgaccatggcctttgtgggcctgcccttcaacgtgattcccacccacatcttcgacatg
caggtgcgcttcacgctgaagttcttcacaggtcagcggaagtttccctcccgggagcag
atgattgccgatctggagcaggagatcggagagcggtggggctgcggcgtgcgcaaccag
aagaaagcacatcagatgggcgagcgacagtttgtctactacaatgaactggccagtatc
gcgggcatcgagaacatcaagccagttatccacaagctaatgaaggactgcggcaagaag
tacatttttgaattggacacgtacaggagcaacaagtatacgattttggacgatgaaaac
tttttgaagaacggagaagctattgtatga

DBGET integrated database retrieval system