KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3176
Entry
Dmel_CG3176       CDS       T00030                                 
Symbol
CG3176
Name
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 30990
NCBI-ProteinID: NP_001259096
FlyBase: FBgn0029524
UniProt: M9PDE1
Position
X:481862..482768
AA seq 101 aa
MLFDGETGNGQGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSIDLSNPPLKSRC
CQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTLL
NT seq 306 nt   +upstreamnt  +downstreamnt
atgcttttcgatggcgaaaccggcaatgggcaaggtcagggccagaataccctgaatcca
ttggggccaggccaggaggagcccgccctatgcgagcagtactatctgctgggcgatggt
tccatcattctgcgcaaccattccatcgacttgtcgaatccgcccctgaaatcgcgctgc
tgccagctcccaacactcatccacgacatatgcgtcaactgcgtgatggatctctgcgag
gagtgtggctactcctgcggcgagtgcgccaagtttatttgccgcaactgcgtgacttta
ttgtga

DBGET integrated database retrieval system