KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31762Help
Entry
Dmel_CG31762      CDS       T00030                                 

Gene name
bru1
Definition
(RefSeq) bruno 1, isoform E
  KO
K02177  bruno
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG31762 (bru1)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     Dmel_CG31762 (bru1)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG31762 (bru1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 RNA_bind Limkain-b1
Motif
Other DBs
NCBI-GeneID: 34648
NCBI-ProteinID: NP_001162963
FlyBase: FBgn0000114
UniProt: Q960Z4
Structure
PDB: 

Position
2L
AA seq 604 aa AA seqDB search
MFTSRASFLANRRMIFDFSEKNNDIYLDAFGMSDKSSSATNSLPNSPIHSNNNNPSLLNN
NNNNSNGTSSNNSLNVGNNNSNPSLGGSNSNALVSVGSNGIMSAAGLVNNNNNPCSANRN
VVAMVDDDACFRLDTDATVTYGEKEPDPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSI
NVLRDKATGISKGCCFVTFYTRHAALKAQDALHNVKTLNGMYHPIQMKPADSENRNERKL
FVGMLNKKLNENDVRKLFEVHGAIEECTVLRDQNGQSKGCAFVTFATKHAAISAIKVTLS
QNKIMEGCTSPLVVKFADTQKEKEQKKIQQIQANLWNLASNINIPLGQTATSVTTPILPN
PPQQPSPVLGADAITPASIQLLQQLQAVGLQHQLLQALTGLGAQQSSSATDTSAVAAAGL
LTPMTVQNLAAIAAMTQPSLSNAAAAAAAATSPGSAQLTNTAALLWSDPNPMASAYMSTA
AGLPQFGSASALSTSPLASVALSAAAAAAAGKQIEGPEGCNLFIYHLPQEFTDTDLASTF
LPFGNVISAKVFIDKQTSLSKCFGFVSFDNPDSAQVAIKAMNGFQVGTKRLKVQLKKPKD
SKPY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccagccgcgcttcgtttttggccaatcgccgcatgattttcgatttctccgag
aagaacaacgatatctacttggatgcttttggtatgagtgataagagcagcagtgcaacg
aacagcctgccgaatagtcccatacacagcaacaacaataatccatcgctgctgaacaac
aacaacaataacagcaacggcaccagcagcaacaacagcttaaacgttggcaacaacaac
agcaatccgagcttgggcggcagcaacagcaacgcactggtttccgtaggcagcaacggt
ataatgtccgccgccggtttggtcaacaacaataacaatccgtgcagcgccaaccgcaat
gtggtcgccatggtcgacgatgacgcctgcttccgtctggatacggacgccacggtgacg
tacggcgagaaggaaccggatccggacaacatcaagatgttcgtcggccaggtgcccaag
tcgatggacgagtcgcagctgcgcgagatgttcgaggagtacggcgccgtgcactcgatc
aacgttctgcgggacaaggctaccggaattagcaagggttgctgctttgtgacattttat
acgagacacgccgccctgaaagcccaggatgctttgcataatgttaagacgctaaatggg
atgtaccatcccattcaaatgaagcccgccgatagcgagaatcgcaatgaacgcaaactc
tttgtgggtatgctaaacaagaagctgaacgagaacgacgttcgcaagctatttgaagtc
cacggagccatcgaggagtgcaccgtccttcgggaccaaaacggacagagcaagggttgt
gccttcgtcacattcgccaccaagcacgctgccatttcggccattaaagtgaccctgagc
cagaacaagatcatggagggctgcacatcgccgctggtcgtcaagttcgccgatacgcaa
aaagagaaggagcagaagaagattcagcaaattcaggccaatctctggaacctggccagc
aacatcaacatacctctgggccaaacggccaccagcgtgaccacgcccatcctgcccaat
ccgccgcagcagccttcgccggttctcggcgcagatgccattaccccggcctccattcaa
ctgctgcagcagctgcaggcggtgggactgcagcaccagttgttgcaagccctcacagga
ctgggagcccagcagagcagctcggcgacggacaccagcgctgtggcggccgcaggactt
ttgaccccgatgaccgtccagaatctagcggccattgcggccatgacgcagccgagtctc
tcgaatgccgccgcggcagccgccgctgccacatcgcctggaagcgcccaactgaccaac
acggctgcgctgctctggtccgatccgaatccaatggcatcggcatatatgtcaacagcc
gccggtctgccgcaattcgggagcgccagtgcattgtccacttcgccgctggccagcgtt
gccctcagcgccgcagccgccgccgcagcgggaaagcagattgaaggacccgagggctgc
aaccttttcatctaccatctgccgcaggagttcaccgatacggatctggcctccacgttc
ctgcccttcggcaatgtgatctcggccaaggtgttcatcgacaaacagacgagcctgtcg
aagtgcttcgggtttgtctccttcgacaatccggactcggcccaggtggccataaaggcg
atgaacggcttccaggtgggcaccaagcgtctcaaggtgcagctgaagaagcccaaggac
tcgaagccctactag

DBGET integrated database retrieval system