KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3186Help
Entry
Dmel_CG3186       CDS       T00030                                 

Gene name
eEF5
Definition
(RefSeq) eukaryotic translation elongation factor 5, isoform A
  KO
K03263  translation initiation factor 5A
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dme03012]
    Dmel_CG3186 (eEF5)
Translation factors [BR:dme03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    Dmel_CG3186 (eEF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-5a EFP_N
Motif
Other DBs
NCBI-GeneID: 37846
NCBI-ProteinID: NP_611878
FlyBase: FBgn0285952
UniProt: Q9GU68
Position
2R
AA seq 159 aa AA seqDB search
MAELDDQFETTDSGASTTYPMQCSALRKNGFVMLKSRPCKIVEMSTSKTGKHGHAKVHMV
GIDIFSNKKYEDICPSTHNMDVPNVKREDLQLIAISDDSFLTLMTESGDLREDLKVPEGE
LGEQLRLDFDSGKDLLCTVLKACGEECVIAIKTNTALDK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttggacgatcaattcgagaccacggattccggcgcatcgacgacctatccc
atgcaatgttcggcattgcgcaaaaacggattcgtcatgctgaagtcgcggccatgcaag
attgtcgagatgtctacttcaaagactggaaagcacggacacgccaaggttcatatggtt
ggcattgatattttctctaacaagaaatatgaagatatttgcccatctactcataacatg
gatgtgcccaatgtcaaaagggaggaccttcagttgattgctattagtgacgatagcttc
cttacattgatgaccgagagcggagatctgcgtgaagacttgaaggttccagagggcgaa
ttgggtgaacaattgcgtttagattttgatagtggcaaggacttactgtgcaccgttctc
aaggcgtgcggagaggagtgcgttatcgcaattaaaaccaatactgctctggacaaatag

DBGET integrated database retrieval system