KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31902
Entry
Dmel_CG31902      CDS       T00030                                 

Symbol
Spn28Da
Name
(RefSeq) serpin 28Da
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 34082
NCBI-ProteinID: NP_001036345
FlyBase: FBgn0051902
UniProt: Q0E8V6
Position
2L
AA seq 384 aa
MKYLCWILVTTSVLGQFTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANEL
RTALNLPEDKKNVATIYDKLLTKLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFR
AEAEAIKLADRLKAAWAINDWVLDQTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTR
FDKMNTKPKVFYVSKSYQVNVNMMSQVGRFKMRTSTIDQIIELPFAYSNLSMVIVLPKDN
GSLTQAEATIESYPQIVLTEMDVHVQLPKFKIDFRMELVETLKSMGIQDLFNSSSDISVL
LNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDD
DNIYFRGRVVDPLKKSNPIDRITI
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaagtacttgtgttggatcttagtgaccacgtcagtgctaggtcaattcaccaagcaa
ctttaccgaagctttttgcaggataataaacaatataacatcattgcctcgcctctttgc
gtcgagattggaatgagcatgatcctcatgggagcggatggaaatacagccaatgaactg
aggacggctctgaatctgccagaggataaaaagaatgtagctactatatatgataagctt
ttgactaaactcgaaaggggcaagaaggtagccattctccacttggcgaatcgcttgttt
gtcaacgaaacaattggtgttaacaagcgctacaataaactagtcaataagcactttagg
gccgaggcagaagccattaagctggccgatcgattgaaggcagcctgggctataaacgat
tgggtgctcgaccagacactagataatgtgaaagacattataatacccagtgacttgacg
cccgatgaaagtgcggtcatgatcaacgcagctttcttcaagggctactggaagacgcga
ttcgataagatgaacaccaagcccaaggtattctatgtatccaaaagttaccaagtaaat
gtcaatatgatgtcgcaagtgggtcgatttaagatgcgtacttcgaccatagaccaaatt
attgagcttccatttgcatactcaaacctttcaatggtaatcgttctgcccaaggacaat
gggtccctaactcaggcagaagccacaatcgaaagttaccctcagatagttctcactgaa
atggatgtacatgtgcagcttcctaaatttaaaatcgatttccgcatggagctcgtcgaa
actcttaaaagcatgggaatacaggatctcttcaatagttcgtcggatatcagcgtccta
ctgaaccagtctggcactagaatcagccaagtcgtacacaaagcctttatagagattgac
gaagaaggcgggtccgcaggatccgcttctgcgagccccattcgaggattatctgattat
gcgactagtgtggttacttttacagtcaatagtccctttgtcttcatgattcgcgatgat
gacaacatatatttccgtggccgagtcgttgatcctttgaagaagagcaatcccattgac
cgtataaccatatag

DBGET integrated database retrieval system