KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31911Help
Entry
Dmel_CG31911      CDS       T00030                                 

Gene name
Ent2
Definition
(RefSeq) equilibrative nucleoside transporter 2, isoform B
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG31911 (Ent2)
Transporters [BR:dme02000]
 Solute Carrier Family (SLC)
  SLC29: Facilitative nucleoside transporter
   Dmel_CG31911 (Ent2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleoside_tran BTP
Motif
Other DBs
NCBI-GeneID: 33921
NCBI-ProteinID: NP_001285680
FlyBase: FBgn0263916
UniProt: Q9VMB6
Position
2L
AA seq 458 aa AA seqDB search
MAEAKSEKSPFIGKQQAPVTLNPSWESKLPPHDSNGKGSTSVLAKLGLPAPKDKFLIVFF
IFLLHGVGTLMPWNMFITAKSYFEDFKFGPNNTVATEVSYRTHFMQNMGFASQIPNLVFN
WLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVLLNVCN
GIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIFSSKRTSAIYYFVTAIL
VLLLCFDTYFALPLNKFFRHYETISRSSEKKSDSKAQLNVPYWQIFKKAAPQLFNIFLTF
FVTLSVFPAIQSNVHRSDPNFVVGPDYFTLVTCFATFNVFAMLGSLTTSWVQWPGPRFLW
VPVVLRLAFIPLFVMCNYVPPDSVRSLAVFIENDWVYWGIGIAMAYSSGYLSSLGMMYAP
QTVHTKYQTTAGMYAAAMLITGIFSGVLFSYLGPFFVV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctaaatcggagaagtcgccttttattggcaaacagcaggcgccggtgacg
ttaaatccctcgtgggaatccaagttgccgccccatgattccaacggcaagggatcaacg
tcggtgttggcgaaactgggcctgccagcgccaaaagataaattccttatcgtgttcttt
atattcctgctgcacggcgtgggcacgctgatgccatggaacatgttcatcacggccaag
tcctatttcgaggacttcaagttcggaccaaacaacaccgtggccacggaagtgagttac
cgcacccatttcatgcaaaatatgggctttgcctcgcagattcctaacctggtcttcaac
tggctgaacatctttgtcaactttggcggcgacctgaccacccgaatcgtctacagcatc
atcttcgaaatggtcattctgctggttaccattattttggccatgctcgactcctcgcag
tggccgggcgtcttcttctggaccaccatggtgtgcattgtgttgttaaacgtgtgcaac
ggcatctaccagaacaccatatacggaatagtggcatcgttgcccatcaagtacacaggc
gccgtcgtcctgggctccaacatcagcggctgcttcaccaccgccatggccttgatatgc
ggtgagatcttctcgtccaagaggacttcggccatctactacttcgtgaccgccatccta
gtgctgctgctctgcttcgacacgtactttgcgctgccgctgaacaagttcttccggcac
tacgagaccattagccggagcagcgaaaagaaatctgattctaaggcccagctgaacgtg
ccttactggcagatcttcaagaaagcagcgccccaactattcaacatcttcctcacgttt
ttcgtcacgttgtcggttttcccggcgattcagtcgaacgtgcaccgctccgacccaaat
ttcgtagtaggcccggactactttacactggtcacttgcttcgcgacctttaacgtcttc
gcaatgctgggcagtttaaccacatcgtgggtgcaatggccgggtccgaggttcctctgg
gtgccagtggtcttgcgtctggcgttcatccccttgtttgtcatgtgcaactacgttccg
ccggactcggtgcgctcattggccgtattcatcgagaacgattgggtgtactggggcatc
ggcatcgcaatggcctacagctccgggtatctcagctctctgggcatgatgtacgccccg
cagacggtgcacaccaaataccagaccactgccggaatgtacgcagctgccatgctgatc
acgggcatcttctccggagtgctgttctcgtatctgggaccatttttcgtcgtgtag

DBGET integrated database retrieval system